(data stored in ACNUC7421 zone)

EMBL: CP000859.PE491

CP000859.PE491       Location/Qualifiers
FT   CDS_pept        559149..559484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66301"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN7"
FT                   /protein_id="ABW66301.1"
FT                   /translation="MKTNWRVFGIALACLVVLVLVSGLPGSAGQNDLAAEDVQEIVAQE
FT                   TGNQGRILSVGDGSVNIDDVEYFFSGNTRFYSATGKTLSPSSFRTGSLVRFLLDTPSTI
FT                   GVMIKLK"
     atgaaaacaa attggcgtgt ttttggcatc gcgctggcct gtctggtcgt cctggtcctg        60
     gtttccggtt tgccgggcag cgccggccag aacgatcttg ccgctgaaga cgttcaggaa       120
     atcgtggccc aggaaacagg caatcagggc aggattctgt ctgtgggaga cgggtcggtc       180
     aatattgatg acgtggagta ttttttttcc ggtaataccc ggttttactc ggccacaggg       240
     aaaacgcttt ctccttcaag ctttcggacg ggaagtctgg tgcgatttct gctggacacg       300
     ccgtccacga taggcgtgat gatcaagctt aaataa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page