(data stored in ACNUC7421 zone)

EMBL: CP000859.PE493

CP000859.PE493       Location/Qualifiers
FT   CDS_pept        complement(560397..561797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB5546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66303"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN9"
FT                   /protein_id="ABW66303.1"
FT                   /translation="MKIAVLHYHLKPGGVTTVIDRQVAALKNDLDFLVISGQAPDRPLA
FT                   VKTEVVADIGYDRPDTPACTDPAAGADRILAAIRRHWPNGCDLIHVHNPLLAKNRHFLR
FT                   ILAALEERGARLLLHVHDFAEDGRPGAWFADDPYPKKSHFCVINSRDKSILIQAGADAA
FT                   GVHLTPNMVTPLPAAPAPAFVENMALYPVRALRRKNIGEALLLSLFFPGRETVAITLGP
FT                   NSPSDIAPYNQWKTFARDNGLKVRFEASVGQDFAGLVAGSAFIITTSITEGFGFSFLEP
FT                   WTAGKTLWGRKLPDICADFEGAGLDLGHLYAAVNIPVEWIGKAVLAEKIKQAVKKSCLA
FT                   FGLAPATRLDHFTTLADAAFIDFGRLDEAMQQQVLARLMASNAAKETVSAVNPWLNSMG
FT                   TRVDESHIEQNRNAVQAGFNSAVCAGRLLSAYRAAMSVEVAHNIDKAALVDRFFCPETF
FT                   SLLKWGAP"
     atgaaaatcg cggtgcttca ctaccatctc aagcccggcg gggtcaccac ggtgattgac        60
     cggcaggtgg cggcgctgaa aaacgatctg gattttctgg tgatctccgg ccaggccccg       120
     gaccggcctc tggcggtaaa aaccgaggtg gtggccgaca tcggttatga caggcccgac       180
     acaccggcct gcaccgaccc ggcggccggg gccgaccgaa tcctggccgc cattcggcgc       240
     cactggccca acgggtgcga cctgattcat gtgcacaacc cgctgctggc caaaaaccgc       300
     cactttctca ggattcttgc cgccctggag gaacgggggg caaggcttct gctccatgtt       360
     cacgattttg ccgaagacgg ccggcccggc gcctggtttg ccgacgatcc ctatccgaaa       420
     aaaagccact tctgcgtcat caactccagg gacaaaagca ttctgatcca ggccggggcc       480
     gatgccgccg gggtccacct gacgcccaac atggtcaccc cgctgccggc agccccggca       540
     cccgcctttg ttgaaaacat ggccctctac ccggtgcggg cccttcgcag aaaaaacatc       600
     ggcgaagcat tgctgctttc cctgtttttt ccgggccggg agacagtggc cattaccctg       660
     gggcccaaca gcccgtcgga catcgcgcct tataaccaat ggaaaacgtt tgcccgtgac       720
     aacggcctta aagtgcggtt cgaggcgtcc gtcggacagg actttgcggg cctggtggct       780
     gggtcggcct ttatcatcac caccagcatc accgaaggat tcggtttctc ctttttagaa       840
     ccctggactg ccggcaagac gctgtggggc agaaaactgc ccgatatctg cgccgacttt       900
     gaaggtgccg gcctggacct gggacacctg tatgcagcgg tcaacattcc ggtggaatgg       960
     atcggcaaag cggtgctggc agaaaaaatc aaacaggcgg taaaaaaaag ctgccttgcc      1020
     tttggccttg ccccggcaac acggctggat cattttacga ccctggccga tgccgccttt      1080
     attgatttcg gccggctgga cgaggccatg cagcagcagg tgctggcccg cctgatggca      1140
     tcaaatgcgg caaaagaaac ggtcagcgcg gtaaacccct ggctcaacag catgggcacc      1200
     cgggtggatg aatcccacat cgaacagaac cgcaacgccg tgcaggccgg atttaacagc      1260
     gcggtgtgcg ccggccgcct gctttccgcc taccgggccg cgatgagtgt ggaagtggcc      1320
     cacaacatcg acaaggcggc cctggtagac cgattcttct gcccggaaac cttttctctt      1380
     ttaaaatggg gtgccccatg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page