(data stored in ACNUC7421 zone)

EMBL: CP000859.PE497

CP000859.PE497       Location/Qualifiers
FT   CDS_pept        complement(565127..565765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0497"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sat:SYN_01560 queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66307"
FT                   /db_xref="GOA:A8ZTP3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP3"
FT                   /protein_id="ABW66307.1"
FT                   /translation="MSLHVSELFFSIQGESLDAGLACAFVRLAGCNLCCAYCDTAYARQ
FT                   GGTPMEIPEILDRVARFGCSLVEITGGEPLLQKETPLLIQRLLSVGYRVLLETNGTQNI
FT                   GLVDKSCIRIVDVKCPSSGESEKNDARNLDRLAAHDQVKFVISDRTDYLFAKKTAGRIT
FT                   AVAPGHILFSTVHGVLDPAQLAHWMLADGLPVRLHLQLHKILWGEARGK"
     atgagcctgc acgtcagcga actctttttc agtattcagg gggaatccct ggatgccgga        60
     cttgcctgcg cctttgtgcg gctggccgga tgcaaccttt gctgcgccta ctgcgatacc       120
     gcctacgccc gccagggcgg cacccccatg gaaataccgg aaatcctgga ccgtgttgcc       180
     cggttcggct gctccctggt ggagatcacc ggcggcgagc ccctgctgca gaaggagacg       240
     cccctcctga ttcagcgcct gctgtccgtc ggctaccggg ttctgctgga aaccaacggc       300
     acccagaaca ttggcctggt ggataaatcc tgcattcgca tcgttgacgt aaaatgcccg       360
     tccagcggcg aaagtgaaaa gaacgacgcc cgcaacctgg accggctggc cgcccatgac       420
     caggtcaaat ttgtcatatc agaccggacc gattatcttt ttgccaaaaa aaccgccggc       480
     cggatcaccg cggttgctcc gggccacatt ctgttttcaa cggtccacgg cgttttggat       540
     ccggcgcagc ttgcccattg gatgctggca gacggtctgc cggtgcggct tcacctgcag       600
     cttcataaaa ttctctgggg ggaggcgcgg ggaaaatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page