(data stored in ACNUC7421 zone)

EMBL: CP000859.PE501

CP000859.PE501       Location/Qualifiers
FT   CDS_pept        complement(569111..569581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0501"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: sat:SYN_02847 acetyltransferase GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66311"
FT                   /db_xref="GOA:A8ZTP7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP7"
FT                   /protein_id="ABW66311.1"
FT                   /translation="MANDLPLFYTSGITPADIPAITAIETDCFKDPWSMAAVALELSAS
FT                   HAGGMTARCAATHHIAAYIFFRRVLDEMHILKVATARPWQRRHGAWLLMDEAIRRARKM
FT                   GLRQVFLEVRASNIAAIKLYEKTGFTVAGRRPGYYYDDNDDAIMMIHNLKEA"
     gtggcgaatg atcttccgct gttctatacc agcggtatca caccggccga tattcccgcc        60
     atcaccgcaa tcgaaaccga ctgtttcaag gatccatgga gtatggccgc tgtggccctg       120
     gagttatcgg cgtcccacgc cggcggaatg acggcccgtt gcgccgccac ccaccacatt       180
     gccgcgtata ttttttttcg ccgggtcctt gacgagatgc acatcctcaa ggtggccacg       240
     gcccggccct ggcagcgccg ccacggcgcg tggctgttga tggacgaggc gatccggcgg       300
     gcgcgcaaaa tgggcctgcg ccaggtgttt ctggaggtgc gggcgtccaa cattgccgcg       360
     ataaaactct atgaaaaaac gggatttacc gtggccggcc gtcggcccgg ttactattat       420
     gacgacaacg atgacgcaat catgatgatt cacaatttaa aggaggcatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page