(data stored in ACNUC7421 zone)

EMBL: CP000859.PE503

CP000859.PE503       Location/Qualifiers
FT   CDS_pept        complement(569984..570865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sat:SYN_00941 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66313"
FT                   /db_xref="GOA:A8ZTP9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTP9"
FT                   /protein_id="ABW66313.1"
FT                   /translation="MRNFIIHILTGLSGSGKSTALDVFEDAGFYCVDNMPVALLPKFLE
FT                   IPVNTASGISGLAFVMDLREPDFLATYPSVFNDLKAQGYRLTVLFFEAGENVLIQRYSQ
FT                   TRRHHPLAGDKGLVSGIRRERELLEELRASSDTVIDTSTLTIHELKIRLLARIRKSADH
FT                   MPMRIHVMSFGYKYGIPHDADIIMDVRFLPNPYFVDPLKHKNGTDADVAAHVLNHSTGS
FT                   AFLEKFLNLIDFLLPLYKNEPKAYLTVAVGCTGGCHRSVAVATAVFNHMKKREERHVEI
FT                   SHRDLKEAGQTT"
     atgcgcaact tcatcattca cattctcacc ggcctgtccg gttccggcaa aagcacggcc        60
     ctggatgttt ttgaagacgc cgggttttac tgcgttgaca acatgccggt ggccctgctg       120
     ccgaaatttc tggaaatccc ggtaaacacc gcatccggca tatcggggct ggcctttgtc       180
     atggacctgc gggagcccga ttttcttgcc acctaccctt ctgttttcaa cgacctcaag       240
     gcccagggat accggctgac cgttctcttt tttgaagccg gggaaaatgt cctgatccag       300
     cgttacagtc agacccggcg gcaccatccc ctggccgggg acaaggggct ggtttccggt       360
     attcggcggg aacgggaact tttggaggag ctgcgcgcgt cgtcggacac cgtcatcgac       420
     acctccacgc tgaccattca cgagctgaaa atccgcctgc tggccagaat ccgcaaaagc       480
     gccgaccaca tgcccatgcg gattcacgtc atgtccttcg gctacaagta cggtataccc       540
     catgacgcgg acatcatcat ggatgtgcgg tttctgccca acccctattt cgtggatccc       600
     ctgaagcata aaaacggcac ggatgccgac gtggccgccc atgtgctgaa tcactccacc       660
     ggcagcgctt ttttggaaaa gttcttaaac ttgattgact tccttctgcc tttatacaag       720
     aatgagccca aagcatacct gaccgtggcc gtgggctgca ccggcggatg ccaccgaagc       780
     gtggcagtgg cgaccgctgt gttcaaccac atgaaaaaac gggaggagcg ccacgtggaa       840
     atatcacaca gagacctcaa agaggcgggc cagaccacat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page