(data stored in ACNUC7421 zone)

EMBL: CP000859.PE505

CP000859.PE505       Location/Qualifiers
FT   CDS_pept        complement(571510..571845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0505"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   gsu:GSU1886 ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66315"
FT                   /db_xref="GOA:A8ZTQ1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ1"
FT                   /protein_id="ABW66315.1"
FT                   /translation="MQVTVTFKNLEASEHLKQFVSEKLNKFDRLFDSPAKAEVLLSVEK
FT                   FRNIAEINLTGDKLNIIGKEETEDMYAAIDLVMDKIEKQIKKNKQKIKQHRPATRKAAK
FT                   REDTDLP"
     atgcaggtaa cagtcacatt caagaacctg gaggcatcgg agcacctgaa acagtttgtg        60
     tcggaaaaac tcaacaagtt cgaccggctc ttcgactccc ctgccaaagc tgaggtgttg       120
     ctctcggtgg aaaaatttcg caacatcgcg gagatcaacc tgaccgggga caagctcaat       180
     atcatcggca aggaagaaac agaggacatg tatgcggcca tcgacctggt catggacaaa       240
     atcgaaaaac agatcaagaa aaacaaacag aagatcaagc agcaccggcc ggccacccga       300
     aaagccgcca agcgggagga cacggacctg ccgtaa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page