(data stored in ACNUC7421 zone)

EMBL: CP000859.PE506

CP000859.PE506       Location/Qualifiers
FT   CDS_pept        complement(571857..573299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0506"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: ade:Adeh_4167
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66316"
FT                   /db_xref="GOA:A8ZTQ2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ2"
FT                   /protein_id="ABW66316.1"
FT                   /translation="MALDLRQHLKLSQQLVMTPQLQMAIRLLQLNRLEMVDMIQQELSE
FT                   NPALEEAPETAPEDELSTDDREAEALPERVEAEKEVSIEEKISDQVEWENYLNEYNSYG
FT                   GVQFESEAREQPQYESFVASHKSLKDHLLWQFLMTLPTGQEEAIASLIVGNVDDDGYLK
FT                   ADVAEIAATANAPIEQVETILAMLQNFDPPGVCARTLAECLLIQARQLGIDTPVIAGIL
FT                   NNHMKHLESKNYKVIARALKTDTEEIVAAVNLIRTLEPRPGRSFKQEDAGYIIPDIYVH
FT                   KFENDFVIVLNDDDLPRLHISPYYRQAMRGRAAGSKEAKEYLQEKIRSATWLIKSIQQR
FT                   QKTIYAVMNSILKFQRDFFEKGVAHLRPMILRDVAEDIGMHESTISRVTTNKYAHTPQG
FT                   IFELKYFFNSAINRTGADSMASVSVQDKIRQIIKNENPKKPFSDDKIADILKAANINIA
FT                   RRTVTKYREAMGILSSTKRKQF"
     atggcccttg atctgcgaca acacctcaag ctgagccagc aactggtcat gaccccccag        60
     ctgcagatgg ccattcggct gctgcagctc aaccggctgg agatggtgga catgatccag       120
     caggaactgt ccgaaaatcc ggcactggaa gaggccccgg aaacagcgcc cgaagacgag       180
     ctctcaaccg atgacaggga agcggaggcc cttcccgaaa gggttgaagc ggaaaaggag       240
     gtctctattg aagaaaagat ctccgaccag gtggagtggg aaaactacct caatgaatac       300
     aactcctacg gcggggtcca gtttgaaagc gaggccaggg agcagcccca gtatgaatcc       360
     tttgtcgcct cccacaagtc cttaaaggac cacctgctgt ggcagtttct catgaccctg       420
     cccaccggcc aggaagaggc cattgccagc ctgatcgtcg gcaacgtgga tgacgatggt       480
     tatctcaagg ccgatgtggc ggagatcgcg gccacggcca acgcgcccat agagcaggtg       540
     gaaaccattc tggccatgct ccagaatttt gacccgcccg gcgtatgcgc ccggaccctt       600
     gcggaatgcc tgttgatcca ggcccgccag ctgggaatcg acaccccggt gatcgccggc       660
     atcctgaaca accacatgaa gcatctggag tccaaaaatt acaaggtcat tgccagggca       720
     ctgaaaaccg acacggaaga gatcgtggcc gcggtcaacc tgatccggac cttagagccc       780
     cggcccggca gaagcttcaa gcaggaggac gccgggtaca tcattcccga tatttatgtt       840
     cacaaattcg aaaacgattt tgtcattgtt ttaaacgacg acgacctgcc gcgactgcac       900
     atcagcccct actaccggca ggcgatgcgg ggccgggccg ccggatcaaa agaggccaaa       960
     gagtacctgc aggaaaaaat ccggtccgcc acctggctga tcaaaagcat tcagcagcgg      1020
     cagaagacca tctacgcggt catgaacagc atcctcaagt ttcagcgtga tttttttgaa      1080
     aagggggtgg cccacctcag gcccatgatc ctgcgggatg tggccgaaga catcggcatg      1140
     cacgaatcca ccatcagccg ggtcaccacc aacaaatacg cccacacacc ccagggcatc      1200
     tttgaattga aatacttttt caacagcgcc atcaaccgga ccggcgccga cagcatggcg      1260
     tcggtcagcg tacaggacaa aattcggcag atcataaaaa acgaaaaccc caaaaagccc      1320
     ttcagcgacg acaagatcgc tgacatactc aaagcggcca acatcaacat cgcacggcgc      1380
     acggtgacaa aataccggga agccatgggc atcctgtcat ccaccaagcg caaacaattt      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page