(data stored in ACNUC7421 zone)

EMBL: CP000859.PE508

CP000859.PE508       Location/Qualifiers
FT   CDS_pept        complement(574038..574634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0508"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: ppd:Ppro_0972 OstA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66318"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU06"
FT                   /protein_id="ABW66318.1"
FT                   /translation="MPAIETGIWNTMKIQTGLLTICFLVFPALFASADTPPPPQDDAKA
FT                   IHISADRLVSESRADYAEFTGNVRAVGEKFDIQADTLQVFYSPAPDTQAPGTANRLDTG
FT                   TGKTVREIIATGNVTILFDDKVAKTDQAVYSRESGRVVLMGPGSTVTGKSGRISGDTIT
FT                   LHTETESVTVISGGETRVQAVIHPDGSKNDDQTEK"
     atgccggcaa tcgaaacagg catatggaac acaatgaaaa tacaaaccgg actgctgaca        60
     atctgttttc tggtttttcc ggcgctcttc gcgtcggccg acacaccacc ccccccgcag       120
     gacgacgcaa aggccattca tatctctgcg gaccggctgg tctctgaaag ccgggccgac       180
     tatgccgagt ttaccggcaa tgtccgcgcc gtgggcgaaa aatttgacat tcaggccgac       240
     acccttcagg ttttttacag cccggccccg gacactcagg cgcccggaac cgccaaccgg       300
     cttgacaccg gtaccggcaa aaccgtcagg gagatcatcg ccacgggcaa tgtcaccatt       360
     ctgtttgacg acaaagttgc aaaaacagac caggccgtct attcacggga atcgggccgg       420
     gtggtactca tggggcccgg ctccacggtc acgggcaaaa gcggccgcat ttccggagac       480
     accatcaccc tgcacacgga aaccgaaagc gtcaccgtta tcagcggcgg ggaaacaagg       540
     gttcaggcgg tgatccaccc ggacggatcc aaaaacgacg accagacgga aaaataa          597
//

If you have problems or comments...

PBIL Back to PBIL home page