(data stored in ACNUC7421 zone)

EMBL: CP000859.PE513

CP000859.PE513       Location/Qualifiers
FT   CDS_pept        578308..578958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0513"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: dps:DP0107 related to signal peptidase I;
FT                   TIGRFAM: signal peptidase I; PFAM: peptidase S24 and S26
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66323"
FT                   /db_xref="GOA:A8ZU11"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU11"
FT                   /protein_id="ABW66323.1"
FT                   /translation="MTGEETRASTEEKRSDGRSSLRENVEAVLVAVLLALFIRTFAVQA
FT                   FKIPSGSMIPTLQIGDHILVNKFVYGLEVPLLRMPLFDGKDPARGDVIVFKYPEDPQKD
FT                   FIKRVVAVGGDVVDIQNKKVYVNGELLPDAYAIHTDARMVPVRDNLGPIHVPEGKLFVL
FT                   GDNRDNSHDSRFWKFVDMEAVRGKAFIIYWSWNDRPSGVTDRVRWGRIGRMLR"
     ttgaccggag aagagacgcg cgcgtcaacg gaagagaagc ggtccgacgg caggagcagc        60
     ctgcgggaaa atgtggaggc cgtgctggtg gcggtgctgc tggccctgtt tatccggact       120
     tttgcggtcc aggcctttaa gatcccctca ggctccatga ttccgacact tcagatcgga       180
     gaccatattc tggtcaacaa gtttgtctac gggctggagg tgccgctgct gcgaatgccc       240
     ctgtttgacg gaaaggatcc ggcccggggc gatgtcatcg tgttcaagta tcctgaagac       300
     ccgcagaagg atttcatcaa gcgggtggtg gccgtgggcg gggatgtggt ggatattcag       360
     aacaagaaag tttatgtgaa cggcgaactg ctgccggatg cctacgccat tcacaccgac       420
     gcccgcatgg tgccggtacg ggacaacctg ggacccattc atgtgcccga gggcaagctg       480
     tttgtgctgg gcgacaaccg ggacaacagc catgacagcc ggttctggaa gttcgtggat       540
     atggaggccg tgcgcggcaa ggcgtttatc atttattggt cgtggaacga ccggccgtcc       600
     ggcgtgaccg accgggtgcg gtggggcaga atcggccgaa tgctcaggta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page