(data stored in ACNUC7421 zone)

EMBL: CP000859.PE516

CP000859.PE516       Location/Qualifiers
FT   CDS_pept        581241..582647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0516"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: sfu:Sfum_2092
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66326"
FT                   /db_xref="GOA:A8ZU14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU14"
FT                   /protein_id="ABW66326.1"
FT                   /translation="MAGAKANILVVDDELSMRELLDVMLSREGYKVACAEDGTQALSML
FT                   GEMKFDLVLCDVRLGDMSGIDVLKAAKKANHDTVVIMISAYATTEVAVAAMNEGAYDFV
FT                   PKPLDSAELKQTIIRSLSLRTVEQERQALDNSLEDHLYFERIVGSHPKMKHIYNMVRQV
FT                   AQTRTRILITGESGTGKELIARAIHEQSDRANHPFVVVNCGGIPENLMESELFGHRKGS
FT                   FTGAVMDKKGLFTIAHKGTIFLDEIGELSMPLQVKLLRVVQDGAFKQVGGTEEISVDAR
FT                   ILSATNKNLSQEVIDGNFREDLFYRLNVIELNVPPLRERKSDIRVLAQFFVEKFSKDLG
FT                   KEVIKLSSYALDMLEKYSFPGNVRELENLIERSVALSTTNIILPESLSLAVHKRRWIEG
FT                   VPGRRFDLEEVTKGVALDEILADIERAYLKKALESSGGNKNRAAELLGISFRSFRYRLD
FT                   KLNVPWDEEE"
     atggcaggcg ccaaggccaa catactggtg gtggacgatg aactgagcat gcgggagctt        60
     ctggatgtga tgctttcccg tgagggatac aaggtggcct gcgccgagga cggcacccag       120
     gccctttcca tgctggggga gatgaaattc gatctggtgc tgtgtgatgt gcggctgggc       180
     gacatgtcgg gcattgatgt gctcaaagcg gccaaaaagg ccaatcacga caccgttgtg       240
     atcatgatct ccgcctatgc caccaccgag gtggcggtgg cggccatgaa tgagggggcc       300
     tatgactttg tgcccaagcc cctggacagt gccgagctga agcagaccat tatccgttcc       360
     ctgtccctgc gcacagtgga gcaggagcgc caggccctgg acaacagcct ggaggaccac       420
     ctctatttcg aacgcattgt cggcagccat cccaagatga agcatatcta caacatggtc       480
     cggcaggtgg cccagaccag gacccggatt ctgatcaccg gagagagcgg caccggaaaa       540
     gagctgatcg cccgggccat tcacgagcag agcgacaggg cgaaccaccc ctttgtggtg       600
     gtcaactgcg gcggtattcc ggaaaacctg atggagagcg agctgttcgg tcacaggaaa       660
     ggatcgttta ccggtgctgt catggacaag aaggggcttt tcaccattgc gcacaagggc       720
     accatctttc ttgacgaaat cggcgagctg agcatgcccc tgcaggtcaa gctgctgcgg       780
     gtggtccagg acggggcctt caaacaggtg gggggaacag aagagatatc cgtggatgcc       840
     agaattcttt cggccaccaa caaaaatctc tcccaggagg tgattgacgg caatttccgg       900
     gaggacctgt tttaccggct caatgtgatt gagttgaacg tgccccccct tcgtgagcgc       960
     aagagcgata ttcgggtgct ggcccagttt tttgtggaaa aattttcaaa agacctgggc      1020
     aaggaggtga ttaagctctc ctcctatgcc ctggacatgc tggaaaaata cagttttccc      1080
     ggcaatgtgc gggagcttga gaacctgata gaacgcagcg tggccctttc caccaccaat      1140
     atcattctgc cggaaagcct ctccctggcc gtgcacaagc ggcgctggat cgagggggtg      1200
     ccgggccggc ggttcgacct ggaggaggtg accaaggggg tggcgctgga tgagattctg      1260
     gctgacattg agcgggccta tcttaaaaag gccctggaga gcagcggggg caacaagaac      1320
     cgggctgccg aactgctggg catcagcttt cgctcttttc ggtaccggtt ggacaagctg      1380
     aatgtgccgt gggacgaaga agaatag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page