(data stored in ACNUC7421 zone)

EMBL: CP000859.PE517

CP000859.PE517       Location/Qualifiers
FT   CDS_pept        583148..583603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0517"
FT                   /product="tfp pilus assembly protein, major pilin"
FT                   /note="KEGG: sat:SYN_00814 tfp pilus assembly protein,
FT                   major pilin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66327"
FT                   /db_xref="GOA:A8ZU15"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU15"
FT                   /protein_id="ABW66327.1"
FT                   /translation="MLRKMRAKVTLGTQGFTLIELMIVIAIIGILAAIAIPNFIAYRNK
FT                   TFCSATESDANSIASAIADYFSIPANVSVTDGSLESDANGKTYVGTELSNGNTWDVDAT
FT                   NMDNIVIEVTDVSGRCPDDYQTAMDATVSPRGYWDGNSLYVKSMTME"
     atgttaagaa aaatgagagc aaaagtcaca ctgggaaccc agggcttcac cctgattgag        60
     ctgatgatcg ttatcgccat catcggtatt ctggccgcca tcgccattcc caacttcatc       120
     gcctacagaa acaagacctt ctgttcggcc actgaatcgg atgccaactc cattgcatcg       180
     gcgattgctg actacttctc cattccggcc aacgtgtcgg ttaccgacgg ctctcttgag       240
     agcgacgcca acggcaagac ctatgtgggg accgagcttt ccaacggtaa cacctgggat       300
     gtcgacgcca ccaacatgga caatatcgtc atagaggtta cggatgtgtc cggccgttgc       360
     cccgacgatt atcagaccgc catggacgcc accgtcagcc cccggggtta ctgggatggc       420
     aacagcctgt acgtcaagag catgaccatg gagtag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page