(data stored in ACNUC7421 zone)

EMBL: CP000859.PE518

CP000859.PE518       Location/Qualifiers
FT   CDS_pept        583988..585619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0518"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase protein"
FT                   /note="KEGG: sat:SYN_00815
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66328"
FT                   /db_xref="GOA:A8ZU16"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU16"
FT                   /protein_id="ABW66328.1"
FT                   /translation="MLATGCIVILASVPPVSRDALIHHLAVPKMYLRHGGLYEIASMHF
FT                   SYFPMNMDLLYLVPLYFKIDIAAKYVHFLFALFCAGLIYRYLRQTLNRNYGLLGALFFL
FT                   TLPVIVKLSVTVYVDLGLIFFSWASLYLIIQWHDAGFPPRRLILAGIACGLALGTKYNG
FT                   LLLLPILGTLIPILYASEKNRAVFHENFRLRYKNAFAGLGWSAIFIVIALILFSPWMIR
FT                   NMVWKGNPVYPLYNSVFNPPAQPVFSETVEKEETPAKNAFWMRRHVYKESFWQTLSIPV
FT                   RAFFQGQDDNPRYFDGRLNPFLLLLSLAAFIRARQPCFPAFTTHRTVLALFALLFILFV
FT                   LFQTDFRIRYMGPAIPPLVVLSVFGIRNLSDLASRQTGAIKKAGQAAVTAVVLLALFLN
FT                   GHYVYSQFSHIRPQDYLSGAVDRGAYISRFRREYPVIAHANKVLPADARVLCLSIGDRT
FT                   YYLDRDLHLAEDFYDKTGGRYSEADVINKLTRYNTTHVIIDRGVLFDWLRTLPTEDRAV
FT                   FLNVFKNNTRVLYEENNVLLLELALQ"
     ttgctggcga ccggttgcat agtgattctg gcgtcggtgc cgccggtgag ccgggatgcg        60
     ctgattcatc acctggctgt acccaaaatg tatctgcgcc atggagggct ttatgagatt       120
     gcctccatgc atttttcgta ttttcccatg aacatggacc tgctttacct ggtgcccctc       180
     tattttaaaa tcgatattgc cgccaaatat gtccattttc tgtttgcgct gttttgcgcc       240
     ggactgatct atcggtatct gcggcagact ttgaatcgga attatggtct tctgggggct       300
     ctgttttttc tgaccctccc ggtgatcgtg aagctgtcgg taacggttta tgtggacctg       360
     ggcctgatct ttttctcctg ggcatcgctt taccttatta ttcaatggca tgacgccggc       420
     tttccccccc gtcgcctgat cctggccggt attgcctgcg gcctggccct gggcactaaa       480
     tacaacggcc tgctgctgct cccgatcctg ggaaccctca tcccgattct ttatgcatca       540
     gaaaagaaca gagccgtttt tcatgaaaat tttcggctgc ggtacaaaaa cgcttttgcc       600
     ggactgggct ggtccgcgat atttatagtg attgctctga ttcttttttc tccctggatg       660
     attcgcaata tggtctggaa gggcaacccg gtttatcctt tgtataacag cgttttcaat       720
     ccgcccgcgc agccggtttt ttcagaaacg gttgaaaaag aagagacacc ggcaaaaaat       780
     gccttctgga tgcggcgtca tgtctataaa gagtctttct ggcagacact gtcaattccg       840
     gttcgggctt tttttcaggg gcaggatgac aacccccgtt attttgacgg ccggttgaat       900
     ccgtttctgc tgctgctgtc cctggcggcg tttattcgtg ctcggcaacc gtgcttcccg       960
     gcctttacca cccatagaac ggtactggcc ctgtttgccc tgctgtttat actgtttgtc      1020
     cttttccaga ccgattttcg tattcgatat atggggccgg ccattcctcc cctggtggtg      1080
     ctgtctgttt ttggcattcg caacctgtca gacttggcgt cgcggcagac cggcgccata      1140
     aaaaaggcgg ggcaggccgc ggtcacagcc gtggtgctgc tggcgctgtt tttgaacgga      1200
     cactatgttt acagccagtt ttctcatatc cggccgcagg attatctttc cggggccgtg      1260
     gatcggggag cttatatcag ccggttccgt cgggagtatc cggtgattgc ccacgccaat      1320
     aaggtcctgc ctgccgatgc ccgggtgttg tgcctttcca tcggtgaccg gacctactac      1380
     ctggacagag atctccacct ggccgaggat ttttatgata aaaccggcgg gcggtattcg      1440
     gaagcggatg tgataaacaa actgacccgg tacaacacca cccatgtgat catcgacagg      1500
     ggggtacttt ttgactggtt gaggacattg cccacagagg atcgggcggt ttttttaaac      1560
     gtgtttaaaa acaacacccg ggtgctgtat gaagagaaca atgtgctact gctggagctg      1620
     gcgcttcagt ga                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page