(data stored in ACNUC7421 zone)

EMBL: CP000859.PE520

CP000859.PE520       Location/Qualifiers
FT   CDS_pept        586890..587945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0520"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: lbj:LBJ_0629 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66330"
FT                   /db_xref="GOA:A8ZU18"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU18"
FT                   /protein_id="ABW66330.1"
FT                   /translation="MNVLVTGGCGFLGSHVCEYYARRGDQVVSYDNMTKHELERAGFAT
FT                   GKARNHNRDFLAGLGVDLVTADIRDAEQLIDSAAGCDYIVHTAAQPAMTISVEDPALDL
FT                   SSNVMGTFNVLETARRLKVPVASCATIHVYGNRINDTLTEGQARYARQPEAIDEDHPVL
FT                   EGTLTPLHASKAGAELYVRTYIETYGVTAASFRLTGIYGPRQFGGEDHGWVANFAIRSV
FT                   LKRPLTIYGTGKQVRDIVFAGDVCRAFDAFYQKRVPGIYNIGGGPNTAISLLECIALLE
FT                   KLNGEKPDIRFGPDRHGDLRYFVCDVSKARSLLGWRPEVKPEPGIRALLEWIRQNRKCF
FT                   GFTTESKGSLS"
     atgaatgttc tggtgacagg cggctgcggg tttctcgggt cccatgtctg cgaatattac        60
     gcccgccggg gtgaccaggt ggtctcctat gacaacatga ccaagcatga gcttgagcgg       120
     gccgggtttg ccacgggaaa agccagaaat cataaccgtg attttctggc cggcctgggc       180
     gtggacctgg tcacggccga catccgcgat gcggagcagt tgatcgacag cgccgccggg       240
     tgtgactata ttgttcatac tgcggcccag cctgccatga ccatcagcgt ggaagatccg       300
     gcccttgatc tttcttctaa tgtgatggga acatttaatg tactggagac ggcccggcgg       360
     ttgaaagttc ccgtggcgtc atgcgccacg atccatgttt acggcaaccg gatcaacgac       420
     acattgacgg aaggtcaagc ccgctatgcc cggcagcccg aggccattga cgaggatcat       480
     cccgttcttg agggcaccct cacccccctt cacgcgtcaa aggccggggc tgagctttat       540
     gtgagaacct atatcgagac ctacggggtg acggcggcca gctttcggct caccggcatc       600
     tacgggcccc gccagttcgg tggcgaagac catggatggg tggccaactt tgccattcga       660
     agcgtgctga agcgccccct taccatttac ggcaccggca agcaggttcg cgacattgtg       720
     tttgccggcg acgtgtgccg cgcctttgac gctttttacc agaagcgcgt gccgggcatt       780
     tacaacatcg gcggcggccc gaacacggcc atatccctgc ttgagtgcat cgctttgctg       840
     gaaaaactca acggcgaaaa accggacatc cggtttggcc cggaccggca tggagacctg       900
     cggtattttg tctgcgatgt ctcaaaggcc cggtcccttc tgggctggcg cccggaggtg       960
     aagcctgaac cgggcatcag ggcgttactt gagtggattc ggcaaaacag gaaatgcttt      1020
     ggtttcacaa ctgaatcaaa agggagcctg tcgtga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page