(data stored in ACNUC7421 zone)

EMBL: CP000859.PE522

CP000859.PE522       Location/Qualifiers
FT   CDS_pept        588680..589816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0522"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sfu:Sfum_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66332"
FT                   /db_xref="GOA:A8ZU20"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU20"
FT                   /protein_id="ABW66332.1"
FT                   /translation="MRQSKENITTVLLTATSYPRDTQDWRGRFLADMVEALSGRPAVSL
FT                   RTWLPPGILPAGVTTAALPEEARFLEALSEAGGIAHILRSEKLKGIPWALKLLRHLRAV
FT                   YQRESHVSVMHVNWLQNAIPLWGSHTPALITVLGTDYKLLTLPGMVSLLRTVIRQRKTI
FT                   IAPNAHWMQAPLEEKFGDIAQIRPIPFGVQRRWFDIQRQFSGQGINRWLVVSRLTANKI
FT                   GPLFEWGRDVFDAENELCLLGPNQENLPVPEWVTYGGATYPEDLERKWFPSAAGLVTLS
FT                   RHDEGRPQVILEAMATGLPVIASDMAAHRDVVIHKKTGWIVTTPDDLRQAINFMSVPEN
FT                   NRRMGEAAKIWVKEHIGTWEDCAMRYEAAYADLTGKVS"
     atgaggcaat caaaggaaaa catcaccacc gttctgttga cggccacctc ttacccccgc        60
     gacacccagg actggcgggg acggttcctt gccgacatgg tggaggccct ctccggccgg       120
     ccggcggtct ctcttcgaac ctggctgccg ccgggcattc ttccggccgg tgtgaccact       180
     gccgcgcttc cggaagaagc tcgatttctg gaggcccttt ccgaagccgg cggcattgcc       240
     catattttga ggagtgaaaa attaaaaggg atcccctggg cgctgaagct gctcagacac       300
     cttcgcgcag tttatcaaag ggaatcccac gtcagcgtga tgcatgtcaa ctggctgcag       360
     aacgccatac cgttgtgggg cagccacacc ccggcgctga tcacggtgct gggcacggat       420
     tataaactgt tgaccctgcc ggggatggtg agcctgctgc gcacggtgat ccggcagcgc       480
     aaaaccatca tcgcgcccaa tgcccactgg atgcaggcgc cgcttgaaga aaaattcggc       540
     gatatcgcgc aaatccggcc cattcccttt ggtgttcagc gaagatggtt tgatattcaa       600
     aggcaatttt ccggtcaggg gattaaccgg tggctggtgg tgtcccggct gacggccaac       660
     aagatcggcc ccctgtttga gtggggccgt gacgtgtttg atgcggagaa cgaattatgc       720
     ctgctggggc caaaccagga aaacctgccg gtccctgaat gggtcacata cgggggtgcc       780
     acctatccgg aggacctgga gagaaagtgg tttccttcgg cggccggcct ggttaccctg       840
     agccggcacg acgagggaag gccccaggtg attctggagg ccatggccac cggcctgccg       900
     gtgattgcct cggacatggc ggcccatcgg gacgtggtga tccacaaaaa aacaggctgg       960
     atcgtgacca ccccggacga tttaagacag gccatcaatt ttatgagcgt gccggaaaac      1020
     aaccggcgta tgggagaggc ggcaaaaatc tgggtaaaag agcacatcgg cacctgggaa      1080
     gattgcgcca tgcgttacga agccgcctat gcggacttga cagggaaagt atcatga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page