(data stored in ACNUC7421 zone)

EMBL: CP000859.PE523

CP000859.PE523       Location/Qualifiers
FT   CDS_pept        589813..590730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0523"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: sfu:Sfum_0803 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66333"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU21"
FT                   /protein_id="ABW66333.1"
FT                   /translation="MKHPTVLLLGGGGFIGRALAGHLCRTGGPVHVVGRNPVKNFEGGA
FT                   VFHQGSMADRSLLESILPQCDVVIHLASATTPGSSAGRPLAEADTNILPTLKLLDMFRD
FT                   CGNRWMIFVSSGGTLYGNPETVPVNESQPLCPLSYHGAGKIAIEAFLHAFAHDSGKHVT
FT                   ILRPANVYGPGQPLSQGFGFIRTVLEHARMDTEVKIWGDGSTVRDFLYIEDMIKGIESV
FT                   MNADPHTDTYNIGSGEGHSLNNVIKTVEKVCGRPLKVQYSTARQVDVRKIVLDCSKIME
FT                   KTGWKPETSLEEGVRLTWQWMLHQ"
     atgaagcatc caacggttct gctgctgggc ggcggagggt ttatcggccg ggcattggcc        60
     gggcatctgt gccgcacggg agggccggtt catgtcgtgg gccgaaaccc ggtgaaaaat       120
     tttgagggcg gcgcggtgtt tcatcagggc agcatggcgg accgttctct tttggaaagc       180
     attcttcccc aatgcgatgt cgttattcat ctggcctcgg ccaccacgcc aggttcctca       240
     gccggccggc ctctggcgga agccgacacc aacatcctgc ccaccctgaa actgttggac       300
     atgttccgtg attgtggaaa ccggtggatg atttttgttt catccggggg cacactttat       360
     ggaaatcccg aaacggttcc cgtaaacgaa agccagccgc tttgtccgct ttcttaccac       420
     ggtgccggaa agatcgccat tgaggcgttt ctgcatgcct ttgcgcatga ttccggaaaa       480
     catgtgacca ttctccggcc cgccaatgtt tacgggccgg gtcagcccct gagccagggg       540
     ttcggcttta tccgtaccgt tctggaacat gcgcgcatgg acacggaggt gaaaatctgg       600
     ggggacggtt cgacggtacg cgactttctt tatattgagg acatgataaa aggcattgaa       660
     agcgtcatga acgccgaccc ccataccgat acctacaata tcggctccgg agaaggccat       720
     agtctcaata atgtaattaa aaccgtggaa aaggtttgtg gtcgacccct gaaggtccag       780
     tattcaacgg cccggcaggt ggacgtgcgc aagattgtac tggattgttc gaaaatcatg       840
     gaaaaaacag gatggaaacc cgaaacatcg ctggaagaag gagtccggtt aacgtggcaa       900
     tggatgcttc atcagtaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page