(data stored in ACNUC7421 zone)

EMBL: CP000859.PE536

CP000859.PE536       Location/Qualifiers
FT   CDS_pept        602144..603961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0536"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: ppd:Ppro_1060 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66346"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU34"
FT                   /protein_id="ABW66346.1"
FT                   /translation="MIDDFEKLFAPRKVCQILVARKMISKETAEDLLKRYGGVKSKLEK
FT                   AQSARLAAAPPGIRINNPITIVDVMVSMGLSRADTEVGELDEDAVFQALAEEWDVPFKK
FT                   IDPLKLDLELVTNTIPRSFAMNYLSLPIAVENGELIVATPNPFNTTVMDDIARVVHRRV
FT                   VPVVSTKSDIIRTINEFFGFKKSIAAAETQFAAPTVDLGNLEQYVRLAGEGELPLNDSH
FT                   IVNAVNHLFSYALDQHASDIHIEPKRDITMVRMRIDGVLHTIYKIPKKVHYALVSRIKN
FT                   LARMDMAEKRRPQDGRIKTDKGGSEAEVRVSTIPVAFGEKVVMRIMDPDILFQPLEGLG
FT                   FSAEEMNIYQQMANRPNGIILVCGPTGSGKSTTLYSTLRYLSTPDVNITTVEDPIEMVH
FT                   EDFNQISVQPTVGITFGSILRNILRQDPDIIMIGEMRDLETAQNAIQASLTGHLVLSTL
FT                   HTNDAPSSIIRLLDIGVPNFLVQATLVGVVSQRLVRRICPYCREPIEIDAAEFETMGIQ
FT                   TGKRGKLKLYKGKGCTKCRGTGYKGRTGIFELLPYTEAIRALTLPQTDMAKIQAKSREE
FT                   GMMTLREAAVKKMLRGETTYQEVLRVTWE"
     atgatcgacg attttgaaaa actgtttgcc cccagaaaag tatgccagat cctggttgcc        60
     agaaagatga tctcaaagga aaccgccgaa gacctgctca aacggtatgg cggggtgaag       120
     tcaaaactgg aaaaggccca gagtgccagg ctggccgctg ctccgccggg cataaggatc       180
     aacaatccca tcaccatcgt ggatgtgatg gtgtccatgg ggctttccag ggccgacacc       240
     gaggtggggg aactggatga ggatgcggtg ttccaggctc tggccgagga gtgggacgtt       300
     ccgtttaaaa aaatagaccc cctgaagctg gacctggagt tggtcaccaa cacgattccc       360
     cgttcctttg ccatgaacta tctctctttg cccattgccg ttgaaaacgg tgagttgatt       420
     gtggccaccc ccaacccgtt caacaccacg gtaatggatg atattgcccg ggtggtacac       480
     cgcagggtgg tgccggtggt cagcaccaag tcggacatca ttcgtaccat taacgagttt       540
     tttggtttta aaaaatccat tgccgccgct gagacgcagt tcgcggcccc caccgtggac       600
     ctgggcaacc tggaacagta tgtgcgcctg gccggtgagg gtgagcttcc tttaaatgac       660
     agccacatcg tcaacgcggt caaccacctg ttttcttacg cactggatca gcatgccagt       720
     gatattcata ttgagcccaa gcgggacatc accatggtga gaatgcgtat cgacggtgtg       780
     ctgcacacca tttacaagat acccaagaaa gttcactacg ccctggtgag tcgtatcaaa       840
     aacctggcgc gcatggacat ggctgaaaag cggcggcccc aggacggtcg catcaaaacc       900
     gacaaagggg gcagtgaggc ggaggttcgg gtctccacga ttcccgtggc atttggagaa       960
     aaagtggtca tgcggatcat ggacccggac atcctgtttc agccgctgga gggcctgggt      1020
     ttttccgccg aggagatgaa tatttaccag cagatggcca accggcccaa cggcatcatc      1080
     ctggtgtgcg gtcccacggg cagcggcaag tccaccaccc tttactccac gctgcggtat      1140
     ctctctactc cggacgtcaa tatcaccacc gtggaagatc ccattgaaat ggtgcatgag      1200
     gacttcaatc agatttcggt tcagccgacg gtgggcatca cgtttggatc aattctgaga      1260
     aatattcttc gtcaggaccc ggacatcatc atgatcggtg aaatgcggga cctggaaacc      1320
     gcccagaatg ccattcaggc ctcgctgacc ggccatctgg tgctctccac cctgcacacc      1380
     aacgacgctc cttcttctat catccgactg ctggatatcg gggtccccaa cttcctggtg      1440
     caggccacac tggtgggcgt cgtgtcacag cgcctggtga gacggatctg tccttactgc      1500
     cgggaaccca ttgaaataga tgccgctgag tttgagacca tgggcattca gacggggaaa      1560
     cgggggaagc tgaagttgta caagggtaag ggatgcacca agtgcagagg caccggctac      1620
     aaaggccgga ccggcatttt tgagctgctg ccatacacgg aagccattcg ggcgttgacc      1680
     cttccccaga ccgatatggc aaagattcag gccaaaagca gggaagaggg tatgatgacc      1740
     ctgcgagaag cggcggtgaa aaagatgctg cggggtgaaa ctacctatca ggaggtgctg      1800
     cgggtcacct gggaataa                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page