(data stored in ACNUC7421 zone)

EMBL: CP000859.PE545

CP000859.PE545       Location/Qualifiers
FT   CDS_pept        611105..612205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0545"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   ade:Adeh_3522 HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66355"
FT                   /db_xref="GOA:A8ZU43"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU43"
FT                   /protein_id="ABW66355.1"
FT                   /translation="MDTGKTMNWDWEKLQQQQKSRRPSGPGPSGGGGGGTPPQMDELIN
FT                   KFKNMKFSMGPVLIIVAILVILLGSTMVYTVEQREVGVVQRFGKYVRTTYPGLHFKLPM
FT                   GIETLHIVNVDETRSAGFGLSTAQAEKTLFSSRPAAPSNVYDESLMLTGDLNVGIVPWV
FT                   VQYNIKDPIRFLFRVHEAEILLKDLSEATMRLVVGDRSINEVLLIREEIASECRTRLQQ
FT                   ELDDAETGIQVTALELGKTNVPPKVQPSFNAVNKAEQEKETMIFTARKEYNQAIPAAMG
FT                   EAKKTILAAEGYALDRVNRAEGDAAKFMALYKEYSKAKDVTRRRLYLETMKDVLPKLGK
FT                   KYLIDEDQKNVLPLLNLETGNRGVTK"
     atggacacgg gaaaaacaat gaactgggac tgggaaaagc ttcagcagca acaaaaaagc        60
     aggcggccgt ccggccccgg tccatccggg ggcggtggtg gtggaacacc gcctcagatg       120
     gatgaactga tcaataaatt caagaacatg aaattttcca tgggcccggt gctgatcatc       180
     gtggcaatcc tggtgatcct gctcgggtct accatggtct acacggtgga gcagcgggag       240
     gtgggagtgg tccagcggtt cggcaaatat gtgcgcacca cctatcccgg gcttcacttc       300
     aagctgccca tgggcattga aaccctgcac attgtcaacg tggacgagac ccggtccgca       360
     ggcttcgggc tttcaacggc ccaggcggaa aagaccctgt tctcctcccg gccggcggcc       420
     ccgtccaacg tctatgacga gtccctgatg ctcaccggag acctgaacgt gggcatcgtg       480
     ccctgggtgg tgcagtacaa catcaaggat ccgatccggt ttctgttcag agtgcatgaa       540
     gccgagattc tgctcaagga tctgtccgag gccaccatgc gcctggtcgt gggggaccgg       600
     agcatcaacg aggtcctgct gatccgggag gagatcgcct ccgagtgccg aacccgcttg       660
     cagcaagagc tggatgacgc ggaaaccggg attcaggtga ctgccctgga gctgggcaag       720
     accaatgtgc cccccaaggt tcagccctcc tttaacgcgg tgaacaaggc cgagcaggaa       780
     aaggagacca tgatctttac cgcccgcaag gagtataacc aggccattcc cgcggccatg       840
     ggcgaggcca agaaaaccat cctcgccgcg gagggctatg cgctggaccg ggtcaaccgg       900
     gccgagggtg atgccgccaa gttcatggcg ctttacaagg agtattccaa ggccaaggat       960
     gtgacccgcc ggcggctcta tcttgaaacc atgaaggatg tgctgccgaa actgggcaaa      1020
     aaatacctga tcgacgaaga tcagaaaaat gttttgccgc tgcttaatct tgaaaccgga      1080
     aacaggggtg tgaccaagtg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page