(data stored in ACNUC7421 zone)

EMBL: CP000859.PE546

CP000859.PE546       Location/Qualifiers
FT   CDS_pept        612202..613191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0546"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   ade:Adeh_3523 HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66356"
FT                   /db_xref="GOA:A8ZU44"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU44"
FT                   /protein_id="ABW66356.1"
FT                   /translation="MKSRGITTIAVVLVVGIVAFFLSAFIVDETELAIVTRFGKVTREP
FT                   VMEAGLNFRVPFLDKVYLFPKNLREWDGEKGELPTLNKTYIWVDTFARWRIEDPVVFYQ
FT                   RAVNMDKAQRLMGNILDSEVKNAIANQELIETVRNSNRQMASLEELFSSSSEPTDGEAT
FT                   TGTRRGTVKSSEIKVGREQVENIILERAKPKIAELGIDLVDVKIKRINYREDVQESVYD
FT                   RMIAERSQIVEQFRSEGRGEAQRILGEKEKKLKEIQSEAYKTAQTIMGKADARVTEISA
FT                   DAYSRDPEFYSFVKTLSLYAESLDESSSVVLSTDTDFFKYLKGYSDKR"
     gtgaaatcca gaggtataac aacgattgct gtcgtgctgg tcgtcggcat tgtcgctttt        60
     tttctctccg cgtttatcgt ggatgaaact gaactggcca tcgtcacccg ctttggcaag       120
     gtgacccggg aaccggtgat ggaggccggg ctgaactttc gggtgccttt tctggacaaa       180
     gtgtacctgt ttccgaaaaa cctgagggaa tgggacggcg aaaaagggga gctgcccacc       240
     ctgaacaaaa cctatatctg ggtggacacc tttgcccggt ggcgaattga ggacccggtg       300
     gtgttttatc agcgggccgt gaatatggac aaggcccagc ggctgatggg caatattctt       360
     gactcagagg tgaaaaacgc cattgccaac caggagctga ttgagacggt gcggaacagc       420
     aaccggcaga tggcctccct ggaagagctt ttttcatcat cctccgaacc cacagatgga       480
     gaggccacca ccggtacccg gagggggacg gtgaaaagca gcgagatcaa ggtcgggcgg       540
     gagcaggtgg aaaacatcat tctggaacgg gccaaaccca agatcgctga gctgggcatc       600
     gacctggtgg atgtgaagat caagcggatc aactaccggg aggacgtgca ggaatcggtg       660
     tacgaccgca tgatcgccga gcggtcccag atcgtggagc agttccggtc cgagggccgg       720
     ggagaggccc agcggattct gggtgaaaaa gagaagaagt taaaggagat ccagtctgaa       780
     gcatataaaa cggcccagac cattatggga aaggccgatg ccagggtcac ggagatttcc       840
     gctgacgcct actcaaggga tccggagttt tattcgtttg tgaaaacgct ttctctttat       900
     gccgagtccc tggatgaatc cagttcagtg gtgctttcca cagacaccga ttttttcaaa       960
     tacctcaagg ggtattcgga caaacggtag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page