(data stored in ACNUC7421 zone)

EMBL: CP000859.PE547

CP000859.PE547       Location/Qualifiers
FT   CDS_pept        613585..614145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66357"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU45"
FT                   /protein_id="ABW66357.1"
FT                   /translation="MKQKTRQARQATPCFSLDQLAVLNDSVAVAEEMVCDYYKMSASQW
FT                   LRHRYDVKTRAGLSGTEIVEGPFAQIVRYAARGSDASLGSSVYDFYKICVQDPAILSVV
FT                   SATPGLSLFPFLVYVIVHELVHIIRFARFDQHFDAPPEEKEREEGRVHRATRAILVRHE
FT                   IAGMAPVLKFYEKWETCQAPVDL"
     atgaaacaga aaacgaggca ggcccggcag gccacaccct gtttttcctt agaccagctc        60
     gcggtgctca atgattctgt ggccgtggcc gaagagatgg tatgcgatta ctacaagatg       120
     tcggccagcc agtggcttcg ccaccgctac gatgtaaaaa cacgggccgg gctttccggc       180
     actgagatcg tggaaggccc ttttgctcag atcgtccgtt acgcggcccg gggcagcgat       240
     gcgtctctgg gctcttctgt ctatgatttc tataagatat gcgttcagga cccggccatt       300
     ctgtcggttg tttccgccac gcccggtctt tctctttttc cctttctggt ctatgtcatc       360
     gtgcacgaac tggttcacat tatccggttt gcccggtttg accagcactt tgacgcgccg       420
     cccgaagaaa aggagagaga agaggggcgg gtccaccggg ccacccgggc catcctggtg       480
     cggcatgaga ttgccggcat ggcgccggta ttaaaatttt atgaaaaatg ggaaacgtgt       540
     caggcgcctg tcgatttgtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page