(data stored in ACNUC7421 zone)

EMBL: CP000859.PE55

CP000859.PE55        Location/Qualifiers
FT   CDS_pept        62536..63330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0055"
FT                   /product="protein of unknown function DUF980"
FT                   /note="PFAM: protein of unknown function DUF980; KEGG:
FT                   dps:DP1877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65865"
FT                   /db_xref="GOA:A8ZRU8"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU8"
FT                   /protein_id="ABW65865.1"
FT                   /translation="MFHWFSTRRRKKLTAVAFPRAWEAIVQRNVAHFCMLTPDEQARLR
FT                   SLIQVFVAEKQWEGAGGLVLTDEIRISISAQACLLLLGLPHNYYRNVATIIVYPSTVVA
FT                   PPRRPGFFEVPMAPVEPGQAILGQAFHQGPVIIIWDAALQGGRQPELGYNVVYHEFAHK
FT                   LDMLDGAADGTPPLADRAEYRDWVETCSAEYLRLRRDAAQGKPSFLNAYGATNEAEFFA
FT                   VATEQFFDRPREMAAQAPDLYRVLKAYYRQDPVSRLGKNTCT"
     gtgtttcact ggttttccac acgtcgccgc aaaaaactca cggccgttgc ctttccccgg        60
     gcatgggagg ccattgttca acgcaacgtg gcccacttct gcatgctcac gcctgacgag       120
     caggcccggc tgcggtccct gatccaggtc tttgttgccg aaaagcaatg ggaaggggcc       180
     gggggcctgg tgctgacaga tgaaatccgg atatccatat cggcccaggc ctgcctgctg       240
     ctgctgggcc tgccccacaa ctactaccgg aacgtggcca ccatcatcgt ttatccctcc       300
     acagtggtgg cgccgccccg gcggcccggt ttttttgaag tcccgatggc gccggtggag       360
     ccgggccagg cgattctggg ccaggccttt caccaggggc cggtcatcat catctgggac       420
     gcggccctgc aagggggccg ccagccggag ctggggtaca atgtcgtcta ccatgagttt       480
     gcccacaagc tggacatgct ggacggtgcg gccgacggaa ccccgccgct ggccgaccgg       540
     gccgagtatc gggactgggt ggagacctgt tccgcggaat atctccggct tcggcgcgac       600
     gccgcgcagg gaaaaccgtc gtttctcaat gcctatggcg cgaccaacga agccgaattt       660
     tttgccgtgg ccaccgagca gttctttgac cggccccggg agatggccgc gcaggccccc       720
     gacctttacc gggtgctcaa ggcctattac cgccaggacc cggtgtcgcg gctgggcaaa       780
     aacacctgca catag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page