(data stored in ACNUC7421 zone)

EMBL: CP000859.PE553

CP000859.PE553       Location/Qualifiers
FT   CDS_pept        619063..619743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0553"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mxa:MXAN_1525 FHA domain/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66363"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU51"
FT                   /protein_id="ABW66363.1"
FT                   /translation="MTRREIDDTLNLDKEALDFVEQEKFQVEEKVIYSGRKKGACIVFI
FT                   TGPSRGNVVAAHKGTMTIGRDQASDIVINKQYVSKKHAQIISSEDGAKIVDCKSTNGTF
FT                   LNDTLIEQAELKDRDEIKIGSVIMQYFRIDLNDADQERIPAVLEDQKPSAFYNKVFAEV
FT                   QPFFGQMTGRFLDRQIRSHLGKSPGTLEFSDRESLARWLRISAGLLMNEKIADTLAEKI
FT                   LALE"
     atgacccggc gtgaaatcga cgataccctt aacctggata aggaagccct tgactttgtc        60
     gagcaggaaa agtttcaggt ggaggagaaa gtcatctact ccggacgcaa aaaaggggcc       120
     tgcattgtct ttatcaccgg cccgtccagg ggcaatgtgg tggccgcaca caagggaacc       180
     atgaccatcg gccgggacca ggcatcggac attgtcatca acaagcagta tgtttccaaa       240
     aagcacgcgc agatcatctc ttcagaagat ggggcgaaaa ttgttgactg caaaagcacc       300
     aacggcactt ttctcaacga cactctcatt gaacaggccg aacttaagga tcgtgacgag       360
     atcaagatcg gcagcgtgat tatgcagtac ttccgtatcg acctgaatga cgcggaccag       420
     gagcgtatcc cagcggtttt ggaggaccag aaaccatcgg cgttttataa caaggtattt       480
     gccgaggttc agcccttttt cggccagatg accggccggt tcctggatcg ccagattcgg       540
     tcccacctgg gcaagagccc cggcaccctt gagttttcag acagggagag cctggcaaga       600
     tggctccgta tttcagctgg cctgctgatg aatgaaaaaa tcgccgatac cctggcggaa       660
     aagatcctgg cattagagta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page