(data stored in ACNUC7421 zone)

EMBL: CP000859.PE561

CP000859.PE561       Location/Qualifiers
FT   CDS_pept        630197..631093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0561"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dde:Dde_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66371"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU59"
FT                   /protein_id="ABW66371.1"
FT                   /translation="MKESTKRIIRYHGLRPDRAFHNWLYFAHYRIYVKTMLAAARFLQK
FT                   HFGGMWLLSRPFKSVFERYHSKVMTEADVRKILTLNRELDLGPHKQVIPYAYANKIIFD
FT                   EPDFIVVMDCPCRLHREHHCEPVTVCMAVGRYYGQLWLEHSQKFHPRKITQEEALELVR
FT                   SQREKGCITTAWVKVGTGGRTGIICNCCTCCCGGLEGMRMVKAIKGGENVSNVAPSGYK
FT                   VDHDPALCTACGTCISGCMFDAITADENGAPVYNRDACMGCGLCVEHCPRQARSLNKEF
FT                   AEGLFPLDLDMLQEKKQ"
     atgaaagaat ccactaagcg tataataagg tatcacggcc tgcggccgga ccgggccttt        60
     cacaactggc tctattttgc ccactacaga atttacgtta aaaccatgct ggccgccgcc       120
     cggtttctgc agaagcactt cggcggcatg tggctgctca gccgcccttt caagtcggtt       180
     ttcgagcgct accactccaa ggtaatgacc gaggctgatg tgagaaaaat tctcaccttg       240
     aaccgggagc tggacctggg cccccacaag caggtcatcc cctatgccta tgccaacaag       300
     atcatttttg acgagccgga ctttatcgtg gtgatggact gcccctgccg gctgcaccgc       360
     gagcaccact gcgagccggt taccgtgtgc atggccgtag gtcgctacta tggtcaactc       420
     tggctggagc actcccagaa gtttcatccc cgcaaaatca cccaggaaga ggccctggag       480
     ctggtccggt cccagcgcga aaaagggtgc atcaccacgg cctgggtcaa ggtgggcacc       540
     ggcggccgca ccggcatcat ctgcaactgc tgcacctgct gctgcggcgg gctggaaggc       600
     atgcgcatgg tgaaagccat caagggcgga gaaaacgttt ccaacgtggc gccctccggc       660
     tacaaggtgg accacgaccc ggccctgtgc accgcctgcg gcacctgcat ctcgggctgc       720
     atgttcgacg ccatcaccgc cgatgaaaac ggcgcgcctg tctacaaccg ggacgcctgc       780
     atgggctgcg gcctctgcgt ggaacactgt ccccggcagg cccgctccct gaacaaagag       840
     tttgccgagg gcctgttccc cctggacctc gacatgctcc aggaaaaaaa gcagtaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page