(data stored in ACNUC7421 zone)

EMBL: CP000859.PE562

CP000859.PE562       Location/Qualifiers
FT   CDS_pept        631443..631751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66372"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU60"
FT                   /protein_id="ABW66372.1"
FT                   /translation="MAEQPKNSDWVFVAAEVAGDWAGRFVAYRDEVSDISYVPAFYKKE
FT                   EAQACFINLPREKGKKYEIQAVMFEDLAKDATANGCLIFMLDADGRILLKIDPATVD"
     atggcagaac agccgaaaaa cagtgactgg gtatttgtgg cggccgaagt ggccggcgac        60
     tgggcaggcc ggtttgtggc ctaccgggat gaggtctccg atatttctta tgtgccggcg       120
     ttttacaaaa aagaggaggc ccaggcctgc tttatcaacc tgccccggga aaaggggaaa       180
     aaatatgaaa ttcaggcggt gatgtttgag gacctggcca aagacgccac cgccaacggc       240
     tgcctgatct tcatgctgga cgccgacggc cgcattcttc tgaaaatcga tcccgccaca       300
     gtagattga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page