(data stored in ACNUC7421 zone)

EMBL: CP000859.PE564

CP000859.PE564       Location/Qualifiers
FT   CDS_pept        complement(632711..633049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0564"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   gsu:GSU1836 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66374"
FT                   /db_xref="GOA:A8ZU62"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU62"
FT                   /protein_id="ABW66374.1"
FT                   /translation="MKKIEAIIKPFKLDDVKNVLNELGIQGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYIVDFVPKIKLEVVVAASMADKVVDAIAKAALTGKVGDGKIFVMPVEQAVRVRT
FT                   GEKGKDAI"
     atgaaaaaga tagaagccat aatcaagccc ttcaagcttg atgatgtaaa aaacgtctta        60
     aacgaactgg gcattcaggg aatgaccgtg accgaggtca agggctacgg ccgccagaaa       120
     ggccataccg aaatctaccg gggcgcggaa tacatagttg actttgtgcc caagatcaag       180
     ctggaggtgg tggtggcggc aagcatggcc gacaaggtgg tggacgccat tgccaaggcc       240
     gccctcaccg gcaaggtggg cgacggcaag atcttcgtga tgcccgtgga gcaggccgtc       300
     cgggtccgca ccggtgaaaa aggcaaagac gccatctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page