(data stored in ACNUC7421 zone)

EMBL: CP000859.PE567

CP000859.PE567       Location/Qualifiers
FT   CDS_pept        complement(635768..638431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0567"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: gsu:GSU1820 protein-P-II uridylyltransferase,
FT                   putative; TIGRFAM: protein-P-II uridylyltransferase; PFAM:
FT                   amino acid-binding ACT domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66377"
FT                   /db_xref="GOA:A8ZU65"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU65"
FT                   /protein_id="ABW66377.1"
FT                   /translation="MNAGTTTGIDTPATRMRTARERLIADFSAQGKAFDFLSRHTALLD
FT                   DYFISCFEGSRVGPKMNFHKHPFAVIALGGYGRQEMCIHSDIDLLFLFKKQVPPAAEAL
FT                   IREMVYPLWDLGFEVGHATRSVKECVTLAGQDLDVLTSLLDARFLCGMLPLHTQLRERL
FT                   APGLSGRRARNVIAALIQGNQERHRKFGDSSYLLEPNLKEGVGGLRDYHSMLWIARIIS
FT                   PIISPRDLEYYGYLSHDEYADLNRALAFIWTVRNHLHGLAGRKFDQLYLDHQEVIATAM
FT                   GFKTAGGQMAVERFLGRLHSEMEYIRHTNRAFLAEAGYARGYRFARKTRVRQPVAPGIE
FT                   VDRNLLTFASPEAILSRPHLLLDIFEQSARLHLPLGLEARRILREFAFLVDKPFRSDPA
FT                   VTKAFERILAAWAPDAGVLNEMLHTGVLERLIPKMKTIIDRIQFDGYHLFPIARHSIQT
FT                   VERLKALGAKESDAPLCARLYRELGRRKTILLWAGLLHDIGKGEAGGGHSERGAKIAET
FT                   ILSGMGYGPEFTGAVAFLVKEHLLLAKTATRRDINSEETALACARRIGDEKTLSMLYLL
FT                   TVADSMATGPKAWNDWTASVLRDLFLKVLKILEKGELASRKALATVETKTRELLDIAAS
FT                   AEEKTALAAHMEILPPRYCLYVPALNIRAHMDLYRRLGHGDFVWTVASTANGTARTVTI
FT                   CAKDRPGLFSKIAGVFTLNSLDILEAEIYTWKNGIALDVFTVSPPADRIYEHQQWEKAA
FT                   SHLQAALSGDLDLAGAIAARPAPLRTEKTFATRPHRVKIDNEESSFFTIVEVFAYDFPG
FT                   LLFSITDILFQCGIDIWVAKIATKVDQVIDIFYVRTLEGEKVDTPEAVDRLQTMIETML
FT                   ERHEAGNPAPSQTATV"
     atgaatgcag ggaccaccac tggcatcgac acacccgcga cccgcatgcg cactgcacgg        60
     gagcgcctga ttgccgactt ttccgcacag ggcaaggcat ttgactttct ctcccgccac       120
     accgccctgc tggacgacta ttttatctcc tgctttgaag gcagccgggt ggggccgaag       180
     atgaatttcc acaaacatcc ctttgccgtc atcgccctgg gcggctacgg ccgtcaggag       240
     atgtgcattc attcggatat cgacctgctg tttctgttca aaaaacaggt gcccccggcg       300
     gctgaggccc tgatccggga aatggtctat cccctgtggg acctgggatt tgaggtaggt       360
     catgccaccc ggtcggtcaa ggagtgcgtg accctggccg gccaggacct ggacgtgctc       420
     acctcccttc tggacgcccg ttttctgtgc ggcatgctgc ccctgcatac ccagcttcgg       480
     gaacggctgg cccccgggct ttccggtcgc cgggcccgca acgtgatcgc ggccctgatt       540
     cagggcaacc aggagcgtca ccgaaaattc ggcgactcct cctacctgct ggagcccaac       600
     ctcaaggagg gcgtgggcgg cctgcgggac tatcactcca tgctgtggat cgcccgcatc       660
     atctcgccca tcatcagccc ccgggacctg gagtactacg gttacctctc ccacgacgaa       720
     tacgcggacc tgaacagggc cctggccttt atctggaccg tgcgcaacca tctgcacggg       780
     cttgccggcc gaaaattcga ccagctctac ctggatcacc aggaggtcat tgcaacggcc       840
     atgggcttca agacggccgg gggccagatg gcggtggagc ggtttctggg acggctgcac       900
     agcgagatgg aatacattcg gcacaccaac cgggcctttc tggccgaggc cggttatgcc       960
     cggggctacc ggttcgcgcg aaaaacccgg gtccggcagc cggtggcgcc gggcatcgag      1020
     gtcgaccgga acctgcttac gtttgcgtca ccggaggcca ttctttcccg gccccacctg      1080
     ctgctcgata tttttgaaca gagcgcccgc ctgcatcttc ccctgggcct ggaagcccgg      1140
     cgcattcttc gggagtttgc ctttctggtg gacaaaccct ttcgcagcga cccggccgtc      1200
     acaaaagcct ttgagcgcat tctggccgcc tgggccccgg atgccggggt gctcaacgaa      1260
     atgctgcaca ccggcgttct ggagcggctt attccaaaaa tgaaaaccat tatcgaccgg      1320
     attcagttcg acgggtacca cctgtttccc attgcccgcc actccattca gaccgtggag      1380
     cggctcaagg ccctgggggc aaaggagagc gacgcccccc tgtgcgcaag gctttacagg      1440
     gagctgggcc gccggaaaac gattctactg tgggccggcc tgcttcacga catcggcaag      1500
     ggcgaggccg gcggcggcca ttcggaacgc ggggcgaaaa tagcggaaac aattctgtcg      1560
     ggaatgggat acggcccgga gtttaccggg gccgtggcct ttctggtgaa agaacatctg      1620
     ctgctggcca aaaccgccac ccgccgggat attaacagcg aagagacggc cctggcctgc      1680
     gcccgccgga tcggtgacga aaaaaccctg tccatgctct acctgctcac cgtggccgac      1740
     tccatggcca ccggccccaa ggcgtggaac gactggaccg cgtcggtgct gcgggacctc      1800
     ttcttaaagg tattaaaaat cctggaaaag ggcgagctgg cctcccggaa ggccctggcc      1860
     accgtggaaa ccaaaacccg ggagctgctg gacatcgccg cctccgcgga ggagaaaacc      1920
     gccctggccg cccacatgga gatcctgccg ccccgctact gcctctatgt gccggccctg      1980
     aacattcgcg cgcacatgga cctttaccgg cggctgggcc atggcgactt tgtctggacc      2040
     gtggcctcga cggccaacgg cacagcccgc accgtaacca tctgcgccaa ggaccggccc      2100
     ggcctgtttt caaagatcgc cggggtgttt acgttaaaca gcctggatat tctggaagct      2160
     gaaatctaca catggaaaaa cggcatcgcc ctggacgtgt ttaccgtaag cccgccggcg      2220
     gaccgaatct acgagcacca gcagtgggaa aaggcggctt cccatcttca ggcggccctg      2280
     tccggagacc tcgacctggc aggggccatc gcggcccggc ccgcgcccct gcgaacggaa      2340
     aagacctttg ccacgcgccc gcaccgggta aagatcgaca acgaagaatc gagctttttt      2400
     accattgtgg aggtgtttgc ctacgacttt ccgggattgc tcttttccat caccgacatt      2460
     ctgtttcagt gcggcatcga tatctgggtg gccaaaatcg ccaccaaggt ggaccaggtg      2520
     atcgacatct tttacgtgcg gaccctggag ggagaaaaag tggacacgcc ggaggccgtt      2580
     gaccggctcc agaccatgat tgaaacaatg ctggaacgac atgaagcggg taatcccgcc      2640
     ccttcacaga cggccaccgt atga                                             2664
//

If you have problems or comments...

PBIL Back to PBIL home page