(data stored in ACNUC7421 zone)

EMBL: CP000859.PE569

CP000859.PE569       Location/Qualifiers
FT   CDS_pept        complement(640569..640871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66379"
FT                   /db_xref="GOA:A8ZU67"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU67"
FT                   /protein_id="ABW66379.1"
FT                   /translation="MEYEKILNPDFWKAFKIPGYALAVLLLLLLMRDINNGLEYIYIQK
FT                   VANFAIGASIISYGHSMLHSTWVNRRKEMDLPFWPQLLALTIHAVWFGFFLYQVV"
     atggaatacg aaaaaatttt aaacccggat ttttggaaag cattcaaaat tcctggatat        60
     gctctcgctg ttctcttgtt gctactgctc atgagagata tcaacaatgg ccttgagtat       120
     atttacattc agaaggtggc caatttcgcc atcggtgcca gtattatttc atatgggcat       180
     tctatgcttc acagcacctg ggtaaatcgc cgaaaagaga tggatctccc gttttggcca       240
     cagcttctgg ctttgacaat tcacgctgtt tggttcggtt tttttctcta ccaagtagtc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page