(data stored in ACNUC7421 zone)

EMBL: CP000859.PE576

CP000859.PE576       Location/Qualifiers
FT   CDS_pept        645626..646480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0576"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Cobyrinic acid ac-diamide synthase; KEGG:
FT                   dps:DP0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66386"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU74"
FT                   /protein_id="ABW66386.1"
FT                   /translation="MIISVASGKGGTGKTTVATNLAVALGPDVQVLDCDVEEPNAHLFL
FT                   KPAFTDMEAVMVMVPAVDEEKCTYCRKCAEICRFRAIAVLGETILTFPELCHSCGGCIE
FT                   VCPEDAVYETSRKVGVVERGTGVGDTAFVHGRLRVSEAMAPPLIKRVRAYTRPSGLTII
FT                   DAPPGTSCPVIASVKDADFVVMVTEPTPFGLHDLKLGVEAVRMLGLPCGLVINRSDIGN
FT                   DEVWRYAEAENLPILMEMPFDRGIAEAYSRGEMVVERFPEWREKFVDMYGRITQLVEKG
FT                   GRK"
     atgatcatca gtgttgccag cggaaagggc ggcaccggaa agaccacggt ggccaccaac        60
     ctggccgtgg ccctgggccc ggacgttcag gtgttggact gcgacgtgga agaacccaat       120
     gcccacctgt ttttaaagcc ggccttcacc gacatggagg ccgtgatggt gatggtgccg       180
     gctgttgacg aagaaaaatg cacctactgc cgcaagtgcg ccgagatatg ccggtttcgc       240
     gccattgccg tgctgggtga gaccatcctc acctttcccg agctgtgcca cagctgcggg       300
     ggctgcattg aagtctgccc ggaagacgcc gtgtatgaaa ccagccgcaa ggtgggtgtg       360
     gtggagcggg gcaccggcgt gggcgacacc gcttttgtgc atggccgcct gcgcgtgagc       420
     gaggccatgg ccccgcccct gattaaaagg gtgcgggcct atacccggcc cagcggtctg       480
     accattattg acgcgccgcc cggcacgtcg tgtccggtaa tcgcgtcggt taaggatgcc       540
     gatttcgtgg tgatggtgac cgaacccacg ccctttggcc tgcatgatct gaagctgggg       600
     gtggaggcgg tgcggatgct gggcctgccc tgcggcctgg tgatcaaccg cagcgacatc       660
     ggcaatgatg aagtgtggcg ttacgccgag gcggaaaacc tgcccatcct gatggagatg       720
     ccgtttgacc ggggcattgc cgaggcttac tcccgggggg agatggtggt ggagcggttc       780
     cccgagtggc gggaaaaatt tgtggacatg tatggccgga tcacccaact ggtggagaaa       840
     gggggccgca aatga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page