(data stored in ACNUC7421 zone)

EMBL: CP000859.PE578

CP000859.PE578       Location/Qualifiers
FT   CDS_pept        647434..647817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0578"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: sat:SYN_01180 dinitrogenase
FT                   iron-molybdenum cofactor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66388"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU76"
FT                   /protein_id="ABW66388.1"
FT                   /translation="MKDGRIAVPSNGAGGLDGTRSGHFGHCDVFTLVDVKDGQIAQVST
FT                   ISNQEHVQGGCMVPVNLLAEHRVNALVVGGIGMRPLAGFRQVGIDVYHDDQRPEIRPVV
FT                   EDLIAGKLLQIRDDQVCGGGGGH"
     atgaaagacg gaagaatcgc cgtcccctcc aacggagcgg gcggcctgga cggcacgcgg        60
     tccggccatt tcggccactg tgacgtgttt accctggtgg acgtgaaaga cggccagatc       120
     gcccaggttt ccaccatttc caaccaggag catgttcagg gcgggtgcat ggtgccggtg       180
     aaccttttgg cggaacacag ggtcaacgcc ctggtggtgg gcggtatcgg catgcgcccc       240
     ctggccggtt tccggcaggt gggcatcgac gtgtaccacg acgatcagcg gcccgaaatc       300
     cgccccgtgg tggaagacct gatcgccggc aagctgctcc agatccggga cgaccaggtg       360
     tgtggcgggg gcggcggcca ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page