(data stored in ACNUC7421 zone)

EMBL: CP000859.PE579

CP000859.PE579       Location/Qualifiers
FT   CDS_pept        648076..648825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0579"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dvl:Dvul_0948 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66389"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU77"
FT                   /protein_id="ABW66389.1"
FT                   /translation="MTTYTIHPIVMGTKVFDKSMMTYQFGAGTPYTIPIYCWYIKGGDK
FT                   TILVDTGERNPICSAEREAAIGGKIYTFEEGLARWGIKPEAIDVVIHTHLHNDHCENDD
FT                   KCPNAVFYVHERELAHLHAPHPLDIRYVEDYLETVEENGQVVTVEGNTDIVDGIRVIHT
FT                   PVHTEGGLTVLIQTPAGTAAITGFCVIDENFNPPKEARAMEMEVIPPGTVVNSYKAYDI
FT                   MQAVRSMADILLPLHEPRFAAMGTIPE"
     atgaccacat acaccatcca tcccatcgtg atggggacca aggtgtttga caagagcatg        60
     atgacctacc agttcggcgc cggcaccccg tataccattc ctatctactg ctggtatatc       120
     aagggcggcg acaagaccat cctggtggac accggggaac ggaatcccat ctgctcggcg       180
     gaacgggaag cggccatcgg cggaaagatc tatacctttg aggagggcct ggcccggtgg       240
     ggtataaaac cggaagccat cgacgttgtg attcacaccc accttcacaa tgaccattgt       300
     gaaaacgatg acaagtgtcc caacgcggtg ttttacgtgc acgaaaggga actggcccat       360
     cttcatgccc cccatcccct ggatatccgg tatgtggaag attacctgga aaccgttgaa       420
     gaaaacggcc aggtggtcac ggtggagggc aacaccgata ttgtggatgg cattcgcgtg       480
     attcacacgc cggtgcacac cgagggcggg ctcacggtgc tgattcagac ccctgccggc       540
     accgcggcca ttacagggtt ctgcgtgatc gacgaaaatt ttaatccccc taaagaggca       600
     cgggccatgg agatggaggt gattccgccg ggcaccgtgg tcaacagcta caaggcctat       660
     gacatcatgc aggcggtccg gtccatggcg gatatcctgc tgccgctgca tgagccccgg       720
     ttcgcggcca tgggcaccat acctgaataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page