(data stored in ACNUC7421 zone)

EMBL: CP000859.PE582

CP000859.PE582       Location/Qualifiers
FT   CDS_pept        649872..651311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66392"
FT                   /db_xref="GOA:A8ZU80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU80"
FT                   /protein_id="ABW66392.1"
FT                   /translation="MRVNQAVEPAPTSLEAEKAQQSLWRLLPRFRGTPWFDQLLANEFL
FT                   PPDVQERRQLAMLQRTVARAFETVPYYGDRFQAAFGRPDIGRLSDLARLPVLTRLDIQA
FT                   HFDRMQSTALKPGQPMLPTQTSGSTGQPVTVLHTVESRRMFGLLKQRELRWFRWNPEKT
FT                   LAAVRSANEIPFSDDNRTAFENTFFCQTPHWPVIGSCFHTGPFCGMSCTAPLETQVRWL
FT                   DHVQPHYLMVIASKLEHLAFGYQQRPVPETLEAALSISQELTPRMRAFVEAVFRVPVHQ
FT                   NYGINEVGIIASRCPEGGRYHVNTELCVVEIVDADGQPCKPGQKGRLLVTALANDAMPL
FT                   IRYDTGDLAEAMEGPCPCGRTLPSFGMVHGRYNSIVSLPDGYWNYWIAFVGNFSSMPSH
FT                   LMQYIRQFQMHLFRDNIFELRLALTPGRPEALIEYVKSAWRPDTDNPPAMRIVEVDGFP
FT                   EPANGKFQMFTSDYITQPPIK"
     atgcgcgtga accaggcggt tgaacctgcc cccacctccc tggaagcgga aaaggcccag        60
     caatcgttgt ggcgccttct gccccgtttt cgtggaactc cctggtttga tcaactgctg       120
     gcaaacgagt tccttccgcc tgatgttcag gagcgccggc agctggccat gctgcagcgc       180
     accgtggcac gcgcctttga aacggttcca tactatggtg atcgtttcca ggccgccttt       240
     ggccggcccg atattggacg gttgtctgac cttgcccggc tgccggtgct gacacgcctc       300
     gatattcagg cccactttga ccgcatgcag tccacggcct tgaaaccggg gcagcccatg       360
     ctgcccacgc agacgtcagg gtcaacggga cagcccgtga ccgtgctgca caccgtggaa       420
     agccgccgca tgttcggcct gctcaagcag cgggagctgc gctggtttcg gtggaatcct       480
     gaaaaaaccc tggccgctgt ccggtcggcc aacgagatcc cgttttcaga cgacaaccgg       540
     accgcctttg agaacacctt tttttgtcaa acccctcact ggccggtgat cggcagctgt       600
     tttcataccg gccctttttg cggcatgagc tgcaccgcgc ctcttgagac ccaggtccgg       660
     tggctggacc atgtacaacc ccactacctg atggtgatcg cttccaagct ggagcacctg       720
     gcctttggat accagcagcg gcccgtgccg gaaaccctgg aggcggcgct ttccatttcc       780
     caggagctga ccccgcggat gcgcgccttt gttgaggccg tttttcgcgt gccggtacac       840
     cagaactacg ggatcaacga agtggggatc attgcctccc gctgccccga ggggggccgg       900
     tatcacgtca acaccgagct ctgtgtggtg gagatcgtgg acgccgacgg tcagccctgc       960
     aagccgggcc aaaaaggccg gctcctggtc acggccctgg ccaacgacgc catgcccctg      1020
     attcgttacg acaccgggga cctggcagaa gccatggaag gaccctgtcc ctgcggccgg      1080
     accctgcctt cctttggcat ggttcacggc cggtacaaca gcattgtgtc gttgcccgac      1140
     ggatactgga attactggat cgcctttgtg ggcaactttt cgtcaatgcc atctcacctg      1200
     atgcagtaca ttcggcagtt ccagatgcat ctttttcggg acaatatctt tgagctgcgc      1260
     ctggccttaa cgccgggccg gccggaggca ctgattgaat atgtgaaaag cgcctggagg      1320
     ccggatacag acaacccgcc ggccatgcgc atcgtggagg tggacggttt tccggaaccg      1380
     gccaatggca agtttcagat gtttacatcg gactatatca cgcaaccgcc aatcaaatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page