(data stored in ACNUC7421 zone)

EMBL: CP000859.PE583

CP000859.PE583       Location/Qualifiers
FT   CDS_pept        651346..651765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66393"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU81"
FT                   /protein_id="ABW66393.1"
FT                   /translation="MRDNLPVGKVYPLSVAPFEEMAHHEMAQWFERFVPVGFPVEMAVH
FT                   NVSVPKGIVPEMYVTPHAHEDHDEINIVLGAGGLSYSIILDGREQKVAAPAAVWVPAGC
FT                   SHSANAVSGEGFFICVKIKKEPVPPGISESDRLLR"
     atgcgcgaca atctgcctgt cggaaaagtc tatcctctat cagttgctcc gtttgaggag        60
     atggcccacc atgaaatggc gcagtggttc gaacggtttg tgcccgttgg attccctgtg       120
     gaaatggcgg ttcacaacgt gtcggtgccg aagggcattg tcccggagat gtatgtaacc       180
     ccccatgccc acgaggacca tgatgaaatc aatattgttc taggcgccgg cgggctgtcc       240
     tacagtatca ttttggatgg tcgcgaacag aaggtggcgg cgccggccgc tgtatgggtt       300
     ccggccgggt gcagccactc ggccaacgcg gtgtccggtg aaggattttt tatctgcgtg       360
     aaaataaaaa aagagcctgt accgcccggt atttccgaat cagacaggct tttgaggtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page