(data stored in ACNUC7421 zone)

EMBL: CP000859.PE584

CP000859.PE584       Location/Qualifiers
FT   CDS_pept        651871..652713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66394"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU82"
FT                   /protein_id="ABW66394.1"
FT                   /translation="MTPSRPEHWSLHARQWRHIGPPLRPCTQDIRIFEQRIAAWHAETR
FT                   PADDSVALLLGVTPEIAAMSWPARTRLLAVDHNLDMVRYVWPGEAGCADSMAVCGRWQQ
FT                   MPVRKAAVSMVIGDGCFILMDFPEGYRRVADVLHQVLLPGGCLISRFFTRPAKAPTVSQ
FT                   LMAGLENGTIRSFDAFRIQLAMALQGDDVEKGVCLNDVWQAWQNADIDKEQIARNLGWT
FT                   PEAMALMDNYRGQPTRYFLPTQKEVGQIFGERFDLVEFFTGDYEMADLCPIMRFVPQR"
     gtgacccctt cacgcccgga acactggagc ctgcacgcga ggcagtggcg ccatatcggc        60
     ccgccgctgc ggccctgcac gcaagacatt cgtattttcg agcaacgcat cgccgcctgg       120
     catgccgaaa cccggccggc ggacgactcc gtggccctgc tgctgggcgt gaccccggag       180
     atagcggcca tgtcctggcc ggctcgcacg cgcctgctgg ccgtggacca caacctggat       240
     atggtccgtt atgtgtggcc gggtgaggct ggctgcgccg acagcatggc cgtctgcggc       300
     cggtggcagc agatgccggt gcgtaaggcg gctgtttcca tggtgatcgg tgacggctgt       360
     tttatattga tggactttcc ggaggggtat cgccgggtgg cggacgttct gcaccaggtg       420
     ctgttgccgg gcgggtgcct gatatcgcgg tttttcacgc ggccggcaaa ggcgcccacc       480
     gtttcgcagt taatggccgg cctggaaaac gggacaatcc gcagttttga cgcgttcaga       540
     atacaactgg caatggccct tcagggggat gacgtggaaa agggtgtctg cctcaacgat       600
     gtctggcagg catggcagaa tgccgatatc gataaggagc agatcgcccg caacctgggc       660
     tggacacctg aggccatggc cctgatggac aactaccggg gccagcccac ccgttatttt       720
     ttgcccacac agaaagaggt cggtcaaatt tttggcgagc ggtttgacct ggtcgaattc       780
     tttaccggtg attatgaaat ggcggacctg tgcccgatta tgcggtttgt ccctcaaaga       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page