(data stored in ACNUC7421 zone)

EMBL: CP000859.PE586

CP000859.PE586       Location/Qualifiers
FT   CDS_pept        complement(653589..655706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0586"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   sat:SYN_01949 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66396"
FT                   /db_xref="GOA:A8ZU84"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU84"
FT                   /protein_id="ABW66396.1"
FT                   /translation="MAKTQLDFTASADLLEAYGIPILGKMVTDPQQAVQVARDLGYPVV
FT                   LKAISEKIIHKTDAQVVFLNLKTEEAVKNALDRLMENVKQAGAGLPDGILVQKMADPGF
FT                   ELLVGAKQDPGFGPVTMVGHGGRFVELWADVQPGIGILTETDVEEMLSQTMAGTVLNGF
FT                   RGPALDKPAVIRLAINVSRFMADHPEINELDLNPVIVYEQGYAIVDCRLIADDPITVPS
FT                   GTDLSEEKMKSLKAVFSPRSVAIVGASRPGTMGGIILKNCLGIPTVYPINPKLKTVQGL
FT                   TCYPDFDALPEAPDLGVFAVNAEATVESFERFCKAGGRGAIIFSDGFAEIGRKDLEERL
FT                   LELSIQYDVAYIGPNCMGVIDNFSKVNTLFIPEHRTSVIRGSSGIGIISQSGGVGLELM
FT                   EMMEADNLDLGMWVSCGNASSVGVAEILAHMGNDPRIKVIAIYMEGFDNGLKLMQVGKT
FT                   VSAKKPVLVIKGGTGGGAAATLSHTASLAGSHEAFKACCRQAGFYLVEELTEDPKVLVN
FT                   ILSMLSSQPAAGGNRVAVVSVGGGAGILLADRVTEECMELAEFAPETRKALQDLMADNI
FT                   KTARPEDKATIVAGIGSNPLDLFGNCDDDRLLAALRIIADDPNTDIILTAIYLQVPYLS
FT                   EYLPERLIDLQRDLKKPLIVSPRGFSKHVARSRAYLYSKKFHTYTVPMIKPMSIAIKVW
FT                   CDYGRSFIPEE"
     atggccaaaa cccagttgga tttcacagcg tccgccgacc tgcttgaagc atatggaatt        60
     cccattcttg gcaaaatggt cactgatccg caacaggcgg tccaggtcgc ccgggacctt       120
     ggataccccg ttgttttaaa ggccatatcg gaaaagatca ttcacaaaac cgatgcccag       180
     gttgtatttc tgaacctcaa aaccgaagag gccgtcaaaa atgccctgga ccgcctgatg       240
     gaaaacgtga aacaggccgg cgccggtctg ccggacggca tcctggtgca gaaaatggcc       300
     gaccccggat ttgaactcct ggtgggggcc aagcaggacc ccgggttcgg accggtgacc       360
     atggtgggcc atggcggccg ctttgttgag ctgtgggcag acgttcagcc cggtatcggc       420
     attctgaccg aaaccgatgt tgaagaaatg ctttcccaga ccatggccgg caccgttctg       480
     aacgggtttc gcggcccggc cctggacaaa ccggctgtaa ttcggcttgc cataaacgta       540
     tcccggttca tggccgacca tccggaaatt aacgaactgg acttaaatcc cgtgatcgtc       600
     tacgaacagg gatacgccat cgtggactgc cggctcattg ccgatgatcc cattaccgta       660
     ccgtccggca ccgacctttc cgaagaaaaa atgaaaagcc tgaaagccgt tttcagcccc       720
     cggtccgttg ccattgtggg cgcctcccgg cccggcacca tgggcggcat cattctgaaa       780
     aactgcctcg gcatccccac cgtctacccc atcaacccca agctgaaaac cgtccagggc       840
     ctgacctgct acccggattt tgacgccctg cccgaagccc cggacctggg ggtttttgcc       900
     gtcaacgccg aagccacggt ggaaagcttt gagcgattct gcaaggcagg cggccggggc       960
     gccatcatct tcagcgacgg atttgccgaa atcggcagaa aagacctgga agagcggctc      1020
     ctggagttga gcatacaata tgacgtggcc tatatcggcc ccaactgcat gggggtgatt      1080
     gacaattttt caaaggtcaa caccctgttc ataccggaac accgcaccag cgtcatcagg      1140
     gggtccagcg gtatcggcat catctcccag agcggcggcg tgggccttga actgatggaa      1200
     atgatggagg ccgacaacct ggatcttggc atgtgggtga gctgcggaaa cgccagctcc      1260
     gtgggcgtgg cggaaattct ggcccacatg ggaaacgacc ccagaataaa ggtgatcgcc      1320
     atctacatgg aaggttttga caacggcctc aagctgatgc aggtgggcaa aacggtttcg      1380
     gcaaaaaaac cggtgctggt catcaagggc ggcaccgggg gcggggccgc ggccaccctc      1440
     tcccataccg cttctctggc cggcagccac gaggccttca aggcctgctg ccgccaggcc      1500
     ggtttttacc ttgtggaaga gctgacagaa gaccccaagg tcctggtcaa cattctctcc      1560
     atgctcagtt cccagccggc ggccggaggc aaccgggtgg ccgtggtcag cgtggggggc      1620
     ggtgccggca tcctgctggc cgaccgggtg accgaagagt gcatggagct ggccgagttt      1680
     gcgccggaaa ccagaaaggc ccttcaggac ctgatggcgg acaatatcaa aaccgcccgg      1740
     ccggaagaca aggccaccat tgttgccggc atcggctcaa acccgctgga cctgttcggc      1800
     aactgtgatg acgaccgcct gctggccgcc ctgcggatta tcgccgacga ccccaacacg      1860
     gacatcatcc tcaccgcgat ctacctgcag gtgccctacc tgtctgaata cctgcccgag      1920
     cggctcattg acctgcaaag agaccttaaa aaacccctga tcgtctcccc gcgcgggttt      1980
     tccaaacacg tggccagaag cagggcctac ctgtattcaa aaaaatttca cacctacacc      2040
     gtgcccatga taaagcccat gagcattgcc atcaaggtgt ggtgtgatta cggaagatcg      2100
     tttattccgg aggagtag                                                    2118
//

If you have problems or comments...

PBIL Back to PBIL home page