(data stored in ACNUC7421 zone)

EMBL: CP000859.PE588

CP000859.PE588       Location/Qualifiers
FT   CDS_pept        complement(657664..658968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0588"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gme:Gmet_2078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66398"
FT                   /db_xref="GOA:A8ZU86"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU86"
FT                   /protein_id="ABW66398.1"
FT                   /translation="MNPIAKELNDILQAKSPHIFDMLSDVGKSLFFPKGILSQSAEAKE
FT                   KAHAINATIGIAKEEGGIMCLPSVMDQVAPLVPEESLTYAPSFGIPGLRKAWQKGLYEK
FT                   NPSLAGQAVSLPVVTCGITHAISVFADVWTNPGDTVLLPHMFWGNYNMILNVRGGVNLS
FT                   HFPLFNEAGGFNVKGFEKAARAAAEKDGKLITLLNFPQNPTGYTLTHAEGEAMTAVLTD
FT                   IAAGGTNVMVVCDDSYFGLFYEENVMKESLFARLCGAHERLLAIKLDGATKENYVWGLR
FT                   IGFITYGCKAGASADVYDALEKKTAGCVRGSISNASHLGQSIVLKSLENANYQKERQAK
FT                   GEVLKARANKVKQVLADSRFDDAWEVYPFNSGYFMCLKLKKVKAETLRVHLLDKYGVGL
FT                   IALGEHDLRVAFSCIEEADVQRLFDIIYKGAKELQ"
     atgaacccga tcgcaaaaga gttgaacgat attctgcagg caaaaagccc ccatattttt        60
     gacatgctgt ccgacgtggg caagtccctg ttttttccca agggcatttt aagccagagc       120
     gccgaggcca aggaaaaggc ccacgccatc aacgccacca tcggcattgc caaggaggag       180
     gggggcatca tgtgcctgcc ctcggtcatg gaccaggtgg cgcccctggt gccggaagaa       240
     tccctcacct acgcgccctc cttcggcatt cccggcctgc gcaaggcatg gcagaaggga       300
     ctgtatgaga aaaacccctc ccttgcgggc caggccgtca gcctgccggt ggtaacctgc       360
     ggcatcaccc acgccatcag cgtgtttgcc gatgtgtgga ccaatcccgg cgacaccgtg       420
     cttttgcccc acatgttctg gggcaactac aacatgatcc tcaacgtgcg ggggggggtg       480
     aacctgagcc actttccgct tttcaacgag gcgggcggct ttaacgtaaa agggtttgag       540
     aaagcggccc gggccgccgc ggaaaaagac ggcaagctca tcaccctgct caactttccc       600
     cagaacccca cgggctacac cctgacccat gcggaagggg aggccatgac cgctgtcctg       660
     accgacatcg cggccggcgg caccaacgtg atggtggtgt gcgacgactc ctacttcggc       720
     cttttttacg aagagaacgt gatgaaagag tcgctgtttg ccaggctctg cggggcccac       780
     gagcggctgc tggccatcaa actggacggc gccaccaagg agaattacgt gtggggcctg       840
     agaatcgggt ttatcaccta tggctgcaag gccggggctt cagccgatgt gtatgacgcc       900
     ctggagaaga aaaccgccgg gtgcgtgcgg ggctccatct ccaacgcctc ccacctgggc       960
     cagtccattg tgttaaagtc cctggagaac gccaactacc agaaagagcg gcaggcaaaa      1020
     ggcgaggtgc taaaggcccg ggccaacaag gtcaagcagg tgctggccga ctccaggttt      1080
     gacgacgcat gggaggtcta cccctttaac tccggctatt tcatgtgcct gaagttaaaa      1140
     aaggtcaagg ccgaaaccct gcgggtccac ctgctggaca aatacggggt gggcctgatc      1200
     gccctgggcg aacacgacct gcgggtggcc ttttcctgca ttgaggaggc cgatgtccag      1260
     cggctgttcg acatcatcta taaaggggca aaagagctgc aataa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page