(data stored in ACNUC7421 zone)

EMBL: CP000859.PE59

CP000859.PE59        Location/Qualifiers
FT   CDS_pept        complement(65937..67118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0059"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: gsu:GSU2049 amino-acid N-acetyltransferase /
FT                   glutamate N-acetyltransferase; TIGRFAM: arginine
FT                   biosynthesis bifunctional protein ArgJ; PFAM: arginine
FT                   biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65869"
FT                   /db_xref="GOA:A8ZRV2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV2"
FT                   /protein_id="ABW65869.1"
FT                   /translation="MECPGFQWAGVCAGIKNLKKKDLGLLVSDTPAAVAAVFTANRVKA
FT                   APVLLDMERVASGRCRAIVANSGNANCCTGDAGMAAALAMTKAVAEALGIDEALVLVAS
FT                   TGVIGAPMPTETITGAVPGLVKALRPDGLPDFSESILTTDRFAKSALRNVRLENGTTVT
FT                   VCATAKGAGMIRPDMATMLCFVCTDLQADTDALSGMLSVAVDRSFNRITVDGDTSTNDT
FT                   VFLMAGGASGAGLQTDADRQGFQQALDDVLTELARMMVTDGEGATKLVEVRVKGAKSDA
FT                   DARRVADTVANSSLVKTAFFGQDANWGRIMAAAGRAGVDLSPDAVDIFFDDVQMVKNGM
FT                   GCGPEAERKASGVLKQPTICLGIDLNTGGTGAATVLTCDLSIEYVKINADYRT"
     atggagtgcc ccggttttca atgggccggt gtgtgcgcgg gcatcaaaaa cttgaagaaa        60
     aaagacctgg gcctgctggt gtctgacacg ccggccgccg tggccgcggt gtttaccgcg       120
     aacagggtca aggctgcgcc cgtgctgctg gacatggagc gggtggcatc gggccggtgc       180
     cgggccattg tggccaacag cggcaatgcc aactgctgca ccggggatgc ggggatggcc       240
     gccgcccttg ccatgacaaa ggccgtggcc gaggccctgg gcattgatga ggccctggtg       300
     ctggtggcct ccaccggcgt tatcggggcg cccatgccca cggaaaccat caccggcgcc       360
     gtgcccggcc tggtaaaggc gttacgtccg gacgggctgc ccgacttttc cgaaagcatt       420
     ttaaccacag accggtttgc caaaagtgcc ctgcgaaacg ttcgcctgga aaacggaaca       480
     accgtcacgg tctgcgccac ggccaaggga gccggcatga tccggccgga catggccacc       540
     atgctctgct ttgtctgcac cgaccttcag gctgataccg acgctctttc cggcatgctt       600
     tccgttgctg tggaccgctc ctttaaccgc atcaccgtgg acggcgacac cagcaccaac       660
     gacacggtgt ttttaatggc cggcggcgcg tccggcgcgg gcctgcaaac ggatgccgac       720
     cggcagggat ttcaacaggc cctggacgac gtgctgaccg agctggcccg aatgatggtg       780
     acggacgggg agggggccac caagctggtg gaggtgcggg tgaagggggc caagtctgac       840
     gccgatgccc ggcgcgtggc cgacaccgtg gccaattcca gccttgtgaa aaccgctttt       900
     ttcggccagg acgccaactg gggccggatc atggccgccg cgggccgggc cggggtggac       960
     ctgtccccgg acgcggtgga tatctttttt gatgatgtgc aaatggtgaa aaacggcatg      1020
     ggatgcggcc ccgaagccga acgcaaggcg tcgggggtgc tcaaacagcc gaccatctgc      1080
     ctgggcattg acctgaacac cggcggcacc ggcgcggcaa cggtgctgac ctgtgacctg      1140
     tctattgagt atgtgaagat caacgccgac taccggacat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page