(data stored in ACNUC7421 zone)

EMBL: CP000859.PE595

CP000859.PE595       Location/Qualifiers
FT   CDS_pept        665691..667595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0595"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   sfu:Sfum_2589 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66405"
FT                   /db_xref="GOA:A8ZU93"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU93"
FT                   /protein_id="ABW66405.1"
FT                   /translation="MTRGAAQRRYWAFYKAIRIFRVEDYFATLDADWFKHRLVALSLCV
FT                   AGVFVVLFARLFFLQVVEGEEYRRLSENNCIRLQRIEPPRGQIFDRNGVNIVDNRPSFD
FT                   LSIIPKDAGNPGKIIERLVALTGIPAARLHGNFVKHKTVNPYKPVLLAQDVGRDVLAVV
FT                   EGHRFDLPGVVMDVTPRRQYLYNGFAAHLIGYLGEISRNELGSDRFAGYEPGSYVGKYG
FT                   AERLYEPFLRGRYGGRQVEVNAGGNVVRVLKTVEAESGHHVYLTLDFNLQQKAEALMAG
FT                   VSGAVIALDPDTGAVLAMVSSPSFPQSRFVDGMSAEEWQALVTDPRRPMENKAIQAEYP
FT                   PASVYKIVTSFAGLEEAVVEPDTTFYCPGYYRYGDRVYRCWAEQGHGRVSVVDALARSC
FT                   DVYYYQVGQRVGVERLSWYAKACGLGRPTGIDLYPEKGGLVPSGQWKRRRLGTAWQGGE
FT                   TLSVAIGQSYNLVTPLQMAVLTAAVANGGVLKRPVILDRVETVEKERLKEGEPRDMGML
FT                   PVSDATLEIVRQGMWKAVNDRHGTAWWSARSRKVEISGKTGTAQVVASPRNGDEEIYAV
FT                   DTHKPHAWFVAYAPSENPVIAVAVIVEHGEHGSSAAGPVAKAMIETYLSDKGGSTDGR"
     atgacgaggg gtgcagcgca acgcagatat tgggcttttt acaaagccat caggattttt        60
     cgggtggaag actatttcgc aacactggat gccgactggt tcaagcatcg gctggtggcc       120
     ctctcccttt gcgtggccgg ggtgtttgtg gtgctgtttg cccggctttt cttccttcag       180
     gtggtggagg gggaggagta ccgccgcctg tcagagaaca actgcattcg ccttcagcgg       240
     atcgagccgc ccaggggcca gatttttgac cgcaacggcg tcaacatcgt ggataaccgg       300
     ccctcctttg acctgagcat cattcccaag gacgccggga accccggcaa gatcattgag       360
     cggctggtgg ccctgaccgg cattcccgcg gcccggctgc acggaaattt tgtcaagcac       420
     aagacagtca atccttataa gccggtgctg ctggcccagg acgtgggccg ggacgtgctg       480
     gccgtggtgg agggccaccg ctttgacctg cccggagtgg tgatggacgt cacgccccgg       540
     cggcagtacc tgtacaatgg gtttgccgct cacctgatcg gctatctcgg ggagatcagc       600
     cgcaacgaac tgggcagcga ccgctttgcg gggtatgagc cgggcagcta tgtgggcaag       660
     tacggggcgg aacggctgta tgaaccgttt ttgaggggca ggtacggcgg ccgccaggtg       720
     gaggtgaatg ccggcggaaa cgtggtccgg gtgttgaaaa ccgtggaagc ggaatccggc       780
     caccatgtct acctgactct tgatttcaac ctgcagcaaa aggccgaggc cctgatggcc       840
     ggcgtgtccg gcgcggtcat cgccctggat ccggacaccg gtgctgtgct ggccatggtg       900
     agcagcccgt cgtttcccca gagccggttc gtggacggta tgtcggccga ggagtggcag       960
     gccctggtga cagacccccg ccggcccatg gagaacaagg ccattcaggc ggaatatccg      1020
     ccggcttcgg tgtacaagat cgtcaccagc tttgccgggc tggaagaggc cgtggtggaa      1080
     ccggacacaa cgttttactg ccccgggtat taccggtacg gggaccgggt ttaccggtgc      1140
     tgggccgagc agggccatgg ccgggtgagc gtggtggatg ccctggcccg gtcctgtgat      1200
     gtctattact accaggtggg ccagcgggtc ggggtggagc gcctgtcctg gtatgccaag      1260
     gcctgtggcc tgggccggcc caccggcatt gacctctatc cggaaaaggg cgggctggtg      1320
     ccgtcaggcc agtggaaacg caggcgcctg ggcacggcct ggcagggcgg ggagaccctt      1380
     tccgtggcca tcggccagag ctacaacctg gtcaccccct tgcagatggc ggtgctgacc      1440
     gcggccgtgg ccaacggcgg cgtgctgaaa cggccggtga tcctggaccg cgttgaaacc      1500
     gtggagaaag agcggttaaa agagggagaa ccgcgggaca tgggcatgct gccggtgagc      1560
     gacgccaccc tggagatcgt gcggcagggc atgtggaagg cggtgaacga ccgtcacggc      1620
     acggcatggt ggtcggcccg cagccgcaag gtggagatca gcggtaagac cggcacggcc      1680
     caggtggtgg ccagcccgcg aaacggagac gaggagattt acgcggtgga cacgcataag      1740
     ccccacgcgt ggtttgtggc ctatgcgccg tccgagaatc cggtcatcgc ggtggccgtg      1800
     atcgtggagc acggcgagca cggatcttcc gccgccggac cggtggccaa ggcaatgatt      1860
     gagacctatc taagtgacaa aggcgggagc acggacggac gatga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page