(data stored in ACNUC7421 zone)

EMBL: CP000859.PE596

CP000859.PE596       Location/Qualifiers
FT   CDS_pept        667592..668698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0596"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: gme:Gmet_0929 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66406"
FT                   /db_xref="GOA:A8ZU94"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU94"
FT                   /protein_id="ABW66406.1"
FT                   /translation="MRESWESRQFDWGLLLPVVALGMIGVIVLYSASASAPAHLQKMLC
FT                   IKQAVWFVLGLVLAGGSLLFHYKRLDNWAIVIYIFSMALLVSVLLWGKAAGGSTRWLPM
FT                   GPVAIQPSELAKIAMIIILARYYAKQATADGLGIKKLLVPILLVGIPFVLIGMQPDLGT
FT                   AMLLALIATVVTLFIKVQKRTLYLMGGVMGVLLALGWFFLLKEYQKQRVLTFLNPDRDP
FT                   LGAGYHIIQSKIAIGSGMVFGKGFMQGTQNALAFLPEQHTDFILSVMAEEWGLVGVSVA
FT                   LFLYLLIIIWGISIGYQCKDNFGIILAVGVTAMIFWHVVVNVGMVMGLLPVVGVPLPLI
FT                   SYGGSSVVTFMLGIGLLLNISMRRSGVE"
     atgagggaga gctgggaatc aagacagttt gactggggcc tgctgctgcc ggtggtggcc        60
     ctggggatga tcggggtgat cgtgctttac agcgcgtcgg cgtcggcccc ggcccacctg       120
     cagaagatgc tgtgcatcaa gcaggccgtg tggtttgtcc tcggcctggt gctggccggc       180
     ggctcgctgc tgtttcacta taagcgcctg gacaactggg ccattgttat ttacattttc       240
     agcatggccc tgctggtgag cgtgctgctc tggggaaagg cggccggcgg ctctacccgg       300
     tggctgccca tggggccggt ggcgattcag ccctccgagc tggccaagat cgccatgatc       360
     atcattctgg cccggtatta cgccaagcag gcgaccgcgg acgggctggg cataaaaaag       420
     ctgctggtgc ccatcctgct ggtcggcatt ccctttgtcc tgatcggcat gcagcccgac       480
     ctgggcacgg ccatgctcct ggccctgatt gccacggttg ttaccctttt tataaaggtt       540
     cagaagcgga ccctctacct gatgggcggg gtcatggggg tactgttggc cctggggtgg       600
     ttttttctgc tcaaggagta ccagaagcag cgggtgctga cgtttctcaa cccggaccgg       660
     gatcccctgg gcgcgggata tcatattatt cagtcgaaaa tcgccatcgg ctcgggcatg       720
     gtgttcggca aggggttcat gcagggcacg cagaacgccc tggcctttct gccggaacag       780
     cataccgatt ttatcctttc ggtcatggca gaggagtggg gcctggtggg ggtcagcgtg       840
     gcgctgtttc tgtatttgct gattatcatc tggggcatca gtatcgggta tcaatgcaag       900
     gataattttg gtattatcct ggcggtcggc gtcaccgcca tgattttctg gcacgtggtg       960
     gtgaacgtgg gcatggtgat ggggctgctg ccggtggtgg gtgtgccgct gcccctgatc      1020
     agttacggcg gttcgtcggt ggtgactttc atgctgggca tcgggttgct gctcaacatc      1080
     agcatgcggc gttccggcgt ggagtga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page