(data stored in ACNUC7421 zone)

EMBL: CP000859.PE597

CP000859.PE597       Location/Qualifiers
FT   CDS_pept        668796..669161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0597"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   afw:Anae109_4500 protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66407"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU95"
FT                   /protein_id="ABW66407.1"
FT                   /translation="MGKTEKGPDAITTFLGADASVEGTVSFEGTIRVDGRVTGKVTSAS
FT                   GTVIIGEKAVIDGDVSVDVAIIKGRVNGTVDAASRIEVYPPAAIEGDIHAPVISIDAGV
FT                   KFNGNCSMASRKHTEIK"
     atgggaaaga cagagaaggg accggatgcc attacgacgt ttctgggggc tgacgcctcg        60
     gtggagggga ccgtcagctt tgaaggcacc atacgggtgg acggccgggt cacgggaaaa       120
     gtcaccagcg cctccggcac ggtgattatc ggggaaaagg cggtgatcga cggcgatgtg       180
     tcggtggatg tggccatcat caagggccgg gtcaacggca cggtggatgc cgcctcccgc       240
     atcgaggtct atccgccggc cgccattgag ggggacattc acgcgccggt gatttccatt       300
     gacgccggcg tgaagttcaa cgggaactgc tccatggcat cgcgtaaaca tacggaaata       360
     aaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page