(data stored in ACNUC7421 zone)

EMBL: CP000859.PE599

CP000859.PE599       Location/Qualifiers
FT   CDS_pept        669853..670455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0599"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: dvl:Dvul_2191 H+-transporting two-sector ATPase, B/B'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66409"
FT                   /db_xref="GOA:A8ZU97"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU97"
FT                   /protein_id="ABW66409.1"
FT                   /translation="MRLFGMCESVKKKAAVIVVVSLMAFCCAGFAVAAEHGAEAAPKGW
FT                   VATDTFRVMNFAVLAIALFLLLRKPVAGALNNRIAGIREELARLEAQKEEARKALEAYN
FT                   ERLKMLDKEAEKIIEDYKKQGEAAKARIMESAQASAAKLEEQARRNIDNEFESARQKLR
FT                   LDIFEQAVARAEALVTEKITPDDQHRLVEEYLDKAVL"
     atgaggctgt ttggaatgtg cgaatcagta aagaaaaaag cggccgtgat cgtggttgta        60
     tcgctgatgg cgttctgctg cgccggtttt gcggttgccg ctgaacatgg ggcggaagcc       120
     gctcccaagg gctgggtggc cacggatacg ttcagggtca tgaattttgc cgttctggcg       180
     attgccctgt tcctgctttt gcgcaagccg gttgccgggg ccttgaacaa tcgcatcgcc       240
     ggtattcgcg aggagcttgc ccgcctggaa gcccagaagg aggaagccag aaaagccctg       300
     gaggcctata acgagcgtct caagatgctc gacaaggagg ccgaaaagat catcgaagat       360
     tacaagaaac agggcgaggc cgcaaaggcc cggatcatgg agagcgccca ggcatcggcc       420
     gccaagcttg aggaacaggc ccggcgcaat atcgacaatg agtttgagtc cgcccggcag       480
     aaactgcggc tggatatatt tgagcaggcc gttgccagag cagaggccct ggtaacggaa       540
     aaaatcactc ctgatgatca gcacaggctg gtcgaagaat atctggacaa ggcggtgcta       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page