(data stored in ACNUC7421 zone)

EMBL: CP000859.PE601

CP000859.PE601       Location/Qualifiers
FT   CDS_pept        671006..672523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0601"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: dps:DP0832 probable ATP synthase, alpha chain
FT                   (AtpA); TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66411"
FT                   /db_xref="GOA:A8ZU99"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZU99"
FT                   /protein_id="ABW66411.1"
FT                   /translation="MEIRAEEISQIIKEQIRGFDKKVELSETGVVLSVGDGIARVYGLE
FT                   KVMTMELVEFPGGILGLVLNLEEDNVGVAIMGEDTNIKEGDIVKRTGRIAQVPVGEAVL
FT                   GRVVDTTGAPIDGKGPINASETRRIEVVAPGVIARKSVHEPCYTGLKAVDAMTPVGRGQ
FT                   RELIIGDRQIGKTAVAIDAILAQKDTDVYCIYVACGQKKSSVAQVAAILEKHGAMEYTT
FT                   IVAACASDPASLQYLAPYAGCSMGEYFRDNGKHALIIYDDLSKQAAAYRQVSLLLRRPP
FT                   GREAYPGDIFYNHSRLLERAAKLNDELGAGSLTALPIIETQAGDVSAFIPTNVISITDG
FT                   QIYLEPNLFFAGIRPAINVGLSVSRVGGAAQVKAMKQVAGTLRLDMAQFRELEAFAAFG
FT                   SDLDAATQRQLTRGARLVEILKQPQYKPLSMEKQVTILFAGTNGHLDELPLDAIAAYEA
FT                   GLYTFIETKYPQVFADLKEKQAFTDEIKQTLTKALGEYGQEFKDTIK"
     atggaaatac gagccgaaga gatcagtcag attatcaaag agcagattag gggtttcgac        60
     aaaaaggtcg aattgagcga aacaggcgtc gtcctctctg ttggtgacgg tatcgcccgg       120
     gtgtatggcc tggaaaaggt catgaccatg gagctggtcg agtttcccgg cggcattctg       180
     gggctggtgc tcaaccttga agaggacaac gtgggcgtgg ccatcatggg cgaagatacc       240
     aacatcaagg agggcgatat cgtcaagcgg accgggcgca tcgcccaggt gcccgttggc       300
     gaggccgttc tgggccgcgt ggtggatacc accggcgcgc ccattgacgg caagggcccc       360
     atcaacgcca gtgaaacccg gcgcatcgaa gtggtggcgc ccggcgttat cgccagaaag       420
     agcgtgcacg agccgtgcta caccggcctg aaggccgttg acgccatgac cccggtgggc       480
     cgtggccagc gcgagctgat catcggcgac cgccagatcg gcaagaccgc cgtggccatc       540
     gacgccattc tggcccagaa ggacacggac gtttactgca tctacgttgc ctgcggccag       600
     aagaaatctt cggtggccca ggtggcggcc atcctggaaa agcacggcgc catggagtac       660
     accaccatcg ttgccgcctg cgcttccgat cccgcctccc ttcagtatct ggccccttat       720
     gccggatgct ccatgggcga gtatttccgg gacaacggca agcacgccct gatcatttac       780
     gacgaccttt ccaagcaggc cgccgcctac cgtcaggtct ccctgctcct gcgccgcccg       840
     ccgggacgtg aagcctatcc gggcgacatt ttttacaacc actcccgtct gctggagcgg       900
     gccgccaagc tgaacgacga gctgggcgcc ggttccctca cggcccttcc cattattgag       960
     acccaggccg gtgacgtgtc ggcctttatt cccaccaacg ttatttccat taccgacggg      1020
     cagatctacc tggaaccgaa cctgttcttc gccggtatcc gtccggccat caacgtgggt      1080
     ctttcagtct cccgcgtcgg cggcgcggct caggtcaagg ccatgaagca ggtggccggt      1140
     accctgcgcc tggacatggc ccagttccgc gaactggaag cgtttgccgc cttcggcagc      1200
     gacctggacg ccgccaccca gcggcagctg acccgcggcg cccggctggt ggaaattctc      1260
     aagcagcccc agtataagcc cctgtccatg gaaaagcagg tcaccattct ttttgccggc      1320
     accaacgggc acctggacga actgcccctg gatgccattg ccgcttatga agccggtctt      1380
     tataccttta tcgagaccaa atacccgcag gtttttgccg acctgaagga gaagcaggcc      1440
     tttacggatg agatcaaaca gaccctgaca aaagcactgg gtgaatacgg acaggagttc      1500
     aaggacacga tcaaataa                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page