(data stored in ACNUC7421 zone)

EMBL: CP000859.PE602

CP000859.PE602       Location/Qualifiers
FT   CDS_pept        672566..673462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0602"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: dde:Dde_0986 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66412"
FT                   /db_xref="GOA:A8ZUA0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA0"
FT                   /protein_id="ABW66412.1"
FT                   /translation="MPSLKEVQLKIKGVKQTKKITKAMNMVATSKLRGAQTNMEAFRPY
FT                   AEKFAEVLGSLAAKAGEETSPLLVPKESVKRVNVVLCTSDRGLCGGFNTNLVRMANAYL
FT                   KRCQEKEIEVSFTHFGKKGRDWCRKMTDCERKSEYLGVVGARFGFNVAVTAGRELINGF
FT                   LNGDYDEVHVIYSEFQGMAKQLPVIRQLLPIPPIETADSPASDGGEDYLAEHICEPSPD
FT                   EILDAMLPKNVFIQIYSALLETSTSEHAARMAAMDNASKACNDMINELTLLYNKARQAA
FT                   ITAELMDIVGGAEALKG"
     atgccatctt taaaagaagt ccaactgaaa ataaagggtg tcaagcagac caagaagatc        60
     accaaggcca tgaacatggt ggccacttcc aagctgcgcg gcgcacagac caacatggag       120
     gcattccggc cctatgcgga gaagtttgcc gaggtgctgg gcagcctggc cgccaaggcc       180
     ggagaggaga ccagcccgct gctggttccc aaagagtcgg taaagcgcgt caacgtggtt       240
     ctctgcacgt cggatcgggg gttatgcggc ggtttcaaca ccaacctggt ccgtatggcc       300
     aatgcgtatc tcaagcgctg ccaggaaaag gagattgagg tctctttcac ccacttcggc       360
     aagaaggggc gtgactggtg ccgcaagatg accgattgcg agcgcaagag cgaatacctc       420
     ggcgtggtgg gcgcccggtt cggatttaac gtggcggtga cagcgggccg ggagctgatc       480
     aacggctttt taaacggtga ttatgacgag gtccatgtta tttacagcga gttccagggc       540
     atggccaagc agttgcccgt gatccggcag ctgctgccga ttccccccat tgagacggcc       600
     gattctccag cgtcggatgg cggggaggat tatctggcgg aacatatctg cgaaccgtcg       660
     ccggatgaaa ttcttgacgc catgcttccc aagaatgttt ttattcagat ttacagcgcc       720
     ctgctggaga catccaccag cgagcacgcg gcccgtatgg cggccatgga caacgcgtcc       780
     aaggcgtgca acgacatgat caacgagctt acactgctgt acaacaaagc caggcaggcg       840
     gccatcacgg cggaactgat ggatattgtg ggtggtgccg aggctcttaa aggttaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page