(data stored in ACNUC7421 zone)

EMBL: CP000859.PE603

CP000859.PE603       Location/Qualifiers
FT   CDS_pept        673501..674904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0603"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: sfu:Sfum_2582 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66413"
FT                   /db_xref="GOA:A8ZUA1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA1"
FT                   /protein_id="ABW66413.1"
FT                   /translation="MSDNIGKVVQVMGPVVDVEFEPGKLPAILTALLITNTVINDEADN
FT                   LVVEVAQHLGDNVVRTIAMDVTDGLVRGMPVKDTGAPITMPVGAASLGRVLNVVGKPVD
FT                   GLGPVSREKTMPIHRPAPLFTEQDTSVNVLETGIKVIDLLVPFPRGGKMGLFGGAGVGK
FT                   TVIMMEMVNNIAMQHGGISVFAGVGERTREGNDLYHEMKDSGVLPKAALIYGQMTEPPG
FT                   ARARVALSALTCAEYFRDVEGQDVLIFIDNIFRFTQAGAEVSALLGRIPSAVGYQPTLA
FT                   VDLGGLQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQIAELGIY
FT                   PSVDPLDSTSRILDAAYIGEEHYRVAREVQQTLQKYKELQDIIAILGMDELSDEDKVTV
FT                   ERARKLQRFLSQPFHVAEVFTGKPGSYVKIEDTVRSFKEICDGKHDDLPESAFYMVGSI
FT                   EEAVAKAKG"
     atgagtgaca atatcggaaa ggtcgtacag gtcatggggc ctgtggtgga cgtcgagttt        60
     gaacccggca agttgcccgc gattctgaca gcgctgttga ttaccaatac cgtcattaat       120
     gatgaggcgg acaacctggt ggttgaggtt gcccagcacc ttggcgacaa cgtggtgcgc       180
     accattgcca tggacgttac cgacggtctg gtgaggggca tgccggtaaa ggacaccggt       240
     gctcccatta ccatgcctgt tggcgcggcc tctcttggtc gtgtgctcaa cgtggtggga       300
     aaacccgtgg acggcctggg ccctgtcagc cgtgaaaaga ccatgccgat tcaccgtccc       360
     gcgcctctgt tcactgagca ggacaccagc gtgaacgttc tggaaaccgg catcaaggtt       420
     attgacctgc tggtgccctt tcccagaggc ggcaagatgg gtctgttcgg cggcgctggc       480
     gtgggcaaga ccgttatcat gatggaaatg gtcaacaaca tcgccatgca gcacggcggt       540
     atttccgtgt ttgccggtgt gggcgagcgg acccgtgaag gcaacgacct ttaccatgaa       600
     atgaaggatt ccggggttct tcccaaggcg gccctgattt acggtcagat gaccgagccc       660
     cccggggccc gtgcccgtgt ggccctttcc gcgctgacct gcgccgaata tttccgtgat       720
     gtggaaggcc aggacgtgct gatcttcatc gacaacatct tccggtttac ccaggccggc       780
     gccgaagtct ccgcccttct gggccgcatt ccctcggcgg tgggttatca gccgacactg       840
     gcggtggacc ttggcggcct tcaggagcgg atcacctcaa ccgacaaggg ctccattacc       900
     gcggttcagt gcgtgtacgt gcccgcggac gaccttaccg acccggcccc tgccaccacc       960
     tttgcccatc tggacggtac agtggtgctt tcccgtcaga tcgccgagct gggcatttac      1020
     ccctcggtgg acccgctgga ctccacctcc cgtattctgg acgcggccta tatcggtgag      1080
     gagcattacc gggtggcccg ggaggttcag cagacccttc agaaatacaa ggaactccag      1140
     gacattatcg ccatcctcgg tatggatgag ctttccgatg aggacaaggt cacggttgag      1200
     cgggccagaa agcttcagcg cttcctgtct cagcccttcc atgtggccga ggtcttcacc      1260
     ggcaagcccg gctcctatgt caagattgaa gacacggttc gaagcttcaa ggagatctgt      1320
     gacggcaagc atgacgacct tccggagtcg gccttttaca tggtgggcag cattgaagaa      1380
     gccgttgcaa aagccaaagg ctaa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page