(data stored in ACNUC7421 zone)

EMBL: CP000859.PE604

CP000859.PE604       Location/Qualifiers
FT   CDS_pept        674928..675329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0604"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: dvl:Dvul_2196 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66414"
FT                   /db_xref="GOA:A8ZUA2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA2"
FT                   /protein_id="ABW66414.1"
FT                   /translation="MAENLRLEVVTPEKTVVSDDAQIVMAPGVLGEFGVLVNHTPFLTS
FT                   LMPGALHYKDTGEKEHLLFVSDGFAEVLPDRITVLVESAERKEDIDLQRAEAARERAEK
FT                   RLESGEDVDFVRAKAALTRAIQRIRVAGA"
     atggctgaaa atttgaggct tgaagtggtt accccggaaa aaacggtggt cagcgacgac        60
     gcgcagatcg tcatggcacc gggcgttctg ggtgaatttg gtgtacttgt caatcacacc       120
     ccttttttaa cgtccctgat gccgggagcc cttcactata aagatacagg tgaaaaagag       180
     cacctgctgt ttgtcagcga cggctttgcc gaggtgctgc ccgaccggat caccgttctg       240
     gtggaatccg ccgaaagaaa agaggatatc gaccttcagc gggccgaggc cgccagagag       300
     cgggcggaaa agcggctgga gagcggggaa gacgttgatt ttgtccgggc aaaggctgct       360
     ttgacacggg cgatacagcg gattcgcgta gccggcgcct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page