(data stored in ACNUC7421 zone)

EMBL: CP000859.PE607

CP000859.PE607       Location/Qualifiers
FT   CDS_pept        676602..676892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66417"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUA5"
FT                   /protein_id="ABW66417.1"
FT                   /translation="MGEHITIHLFGKSYTFEADADVPNAHAVADLLEQEVTVVAKKAGG
FT                   TAISRNPFAMLTQAALNIANECVGLRSDRHRMVQAVTTRSQALIQAMDARL"
     ttgggtgagc atataaccat tcatcttttt ggtaaaagtt atacatttga ggcggatgcg        60
     gatgttccaa atgcgcatgc ggtggctgat ttactggaac aggaggtaac ggtggttgca       120
     aagaaggccg gcggaacggc catttcacgc aacccctttg ccatgcttac ccaggccgcg       180
     ctgaacatcg ccaatgaatg cgtcgggttg cgaagcgacc ggcaccggat ggtgcaggcc       240
     gtgaccaccc ggtcccaggc gctgattcag gcgatggatg cccgtctgta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page