(data stored in ACNUC7421 zone)

EMBL: CP000859.PE612

CP000859.PE612       Location/Qualifiers
FT   CDS_pept        690896..729121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0612"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   gsu:GSU1154 surface repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66422"
FT                   /db_xref="GOA:A8ZUK9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUK9"
FT                   /protein_id="ABW66422.1"
FT                   /translation="MPRIKVGSKAGEKDKKKKRRAARKERPFQFEALEPRLLLSAEMGI
FT                   PPADPENLTATPAPVVENVDRFNDVTTTPAADGIKDDGEVKTVADNGEKEGPAAPEKPD
FT                   PSHALTANDVVDAEPAPGTTLFSDTVDKITAERALRQVVVIDPAVVDTNHLLTAIDGSR
FT                   QDARIINLAGNADLPADTSAGSLLDIYLLDGSRDGVAQLTDILENYDTLDAVHIFSHGD
FT                   TGAVYLGTTPVTGENLADRQNDLTAWGAALAPDGDLLLYGCDVAAGDDGVAFVETLAAF
FT                   TGADVAASTDRTGPVDLDGNWDLEFQTGPVETPVLSNATTGYSHLLETFVSTGDNETFE
FT                   GTGANDIFSFDDNWGSDTIVNGGGSNTVNFSAVSADLIFTFHADGTVSATDGENVLNPA
FT                   EGISTIIAGSGDNRFVFERGAVFSGTINAAAGATNTLDFSGVAPVIDPVDEDAPDRTGL
FT                   DLVFTVHAGGAVSVSADGSAILGSTASMDAIIGGGGDNRFAFADGAAFAGSIDGGEGGS
FT                   TTLDYSAYTSAVAVDLTAGTATGVTGGISNFSNIVGGAGNDILTGDEYANEITGGSGSD
FT                   IIDGGIGDDTLTGGIGNDVFRFSDDWGFDAITDGDVGANTLDFSNATADLEVIFAADGT
FT                   LSVDDYTSLLETGGSVAAITTGTGDDNFVFENAAAFDGTITGGTGTNTLDFSAYQTPVR
FT                   IDLGAGTVDMGGFVNDAGVMEGMTADMPLAYLNSGDGVGVAGITDETLLADLNDSAGVG
FT                   LTVELTTATLLADLNNGAGVGIAPALIATTLLADLHDGAGIGVVDGDDIHITLTNGDTV
FT                   DIDLDGCATLEDVLTAISAADARLGATINADGNGINITDTAGGAGDLAVSTLNYSLAAS
FT                   DLGIEGAGTGNLLEGSMIINGLGIVLTDGTRVNADLSGAVTVADVLAAINAAGGGKLSA
FT                   EVNALGNGINITDTAGGEGDLRVAGLADSPVAANLGIDGYGLDGVLEGSALMHDLRVTL
FT                   TDGTAVDVSLAGVETVGDVLTALNSVDISLYAVINAAGNGFELYDDAGGAGDLAVSALN
FT                   GGTAAPGLGITGTGTGDTLTGTTLVYDISITLTDGTTVNVALGGTATVGEALAAISAAH
FT                   PALSAVINGTNNGINISDTAGGAGNLTIADLGTSTAAADLGIAGTGAGALVAGTVLVAP
FT                   VSTAHFTGISNAAGGAGADLLIGNSQDNVLDGGGGGDTYRFAAGWGSDKIVDYGTDGSD
FT                   VLDFSAVASNLAVTVHADGTVSVTDGASTLDNADIIEGIVGGSGSNTFAFEDQADFAGF
FT                   IDGGTGTGNTLDYSAYTTGVTVGLADVTATGTTGVDNIQNITGGSGDDTLTGDDQANTI
FT                   TGGDGNDTITGGGGADTLSGGAGDDTYVMTNDGATVTITEAAAAGTDTLDYSEWGAPVT
FT                   VNLSTGTAPGTSGVNNIEQAIGTRFADTLAGTTGDDTFVFHDGWGTDTVTDPTATDSDT
FT                   LDFSAVTAALTFTFTGTGAVSVSDGTSALNNVANIENLTGGKGDDHFVFADNWGNYTIT
FT                   SAGDVDNDTLDFSAVTANLTFTIHSDGTVSVTDGTNTLGASGGIDNIVGGSGTNTFVFE
FT                   DQGFLNAYIDGGTGTAILDYSACTTAIAVDVSNMDVTVTRTVDGAAVTTTLIGSASGLK
FT                   GINRIDAVIGGTSAGDTLTGFEEDTAWTLSGENAGSVAGGTTLRNITFSGFENLAGHAD
FT                   HDDTFTIQAAGSLDGALIGHPYGPATGTDTVRIANGAYTTVTLASAGEDAGWIDRDGDQ
FT                   IRYIGIDRVEDLSTATTRTVASAADRTAEVYLAGDPYEKDQEWILTVDGVDYVHTVASD
FT                   NEVLADVIADWVGLLQGAGYVAIARNSTLQVTGPAGTTPVVTATLPDGILFLVDDPETR
FT                   DADIRLERDSGTGRITVVSGSDSFVDFEFVEPTTNLNLETGAGNDRVTVGTGFSPTTAA
FT                   VTIDGQAGADHVAYEVTGIAGTAQTITHAANTLSNSGTAIFTYTADTEYAKDITVFGTA
FT                   GNDQMAMADGAGTTYVVSSTTATFGDITLDDPGAGGILTLNGGDGDDTITVNVTGLAAD
FT                   LVLQGGKGDNTVTAVNGTFATLNLGGDFTTMNAAGATVTDFVFDARPSIANRVTVSRVG
FT                   GQIQIVDETDIGTTTTTINDPTGSLTINTGYNAPETTEYIHLGALTLDADLILDAGSLN
FT                   RNSDGGDTVLIQGDLVLGGHSLEIKADTITVESGVTVNTGDASGTTAGNITLEGHDITL
FT                   ETGASLLAADDVNGDITILAVDNTALFVPLIDIDISHVSFTMKSGAAIEGGNVEIIASA
FT                   SNQQVFENNEEGFGGKALGLLESALGVVEDLNFFITVSYVESTAKIDIQDGSVITAEQF
FT                   TAYANTYADVRAKLIKSWGVGGAAGVAISEASVTLAGELNVTGNVTLRSLADITMDVVA
FT                   TPSPVKGVAVAVGISVIDSESTVHVTDTAELTIGGDLSMRAETIEHSRVLAQSTSGKDG
FT                   AVGLAFAITVEQGSTNAWMDGQAVIGGDVLVSAGMVQEMIEVKKLYFLPSTTIGTGAQA
FT                   GVGSNSSGDVLDDVKSSAQSAILAKVMSPVQGKIDKVTKWFKTKLGISDEPSKEPPFDV
FT                   AGAVSFVYDSNETSARIGDGDDATFDGALDAGGSVLVISSIASCPYVSANASASNNDST
FT                   QPSGGKADSKFSGSAAISIGIYKNDAEAVINDGAVVDAVDDINVCAAALNDYVFVWGRN
FT                   LYDVWVQEADYTTDDAGPVTVLEGQTVEVTSGYTGNGEEGTWYKYLGAADLSVDDWSTV
FT                   DFSDEALWEGINPLHKKGMDFVTNLTTYLSGDFGMSAWLGNSWTQATAEGDTLAIAGAV
FT                   TYLDMANNAEAAIRKDAQINQNDGGDGFGDVVVQAVNLNETVNLGGNINLPGISSEPEE
FT                   GKTLPKLSAQYKPKDLLGTKAEDGKGAVGATVMIYNYKDTTEAVIEDGVILSADSLLVD
FT                   AQTGTMGVNVGASGGQGGKVGFNGVVIVNVVDNETTARIDAGADIAVGSGLVVDGVAFD
FT                   PEDAISLIGDWIDLGGYYGLKAGDSLVYDNGGGTSIGGLTQGETYYVAAVSGTKIRLAD
FT                   ASGNAIGLDKDSATGADHNLTGINSLVVNARDDLFLVDVAGGVAVSSEVGIGASVNVNI
FT                   VNRDTQALIGDLHDTDAADQTAVGDRGTVTVAGNTAVSAVNDGFIGGFSVAGAVAKSSQ
FT                   KAPGSGGGTSSNRGTGGTQGSDGSVTSNDALSSWQSKWASVLGEGKDKGKLSGDVAGDT
FT                   SKSTDQTAQSKSGFAVSGAVVVDVVDDNARAYIFNAGAVTLTSDGSLSVSAGNDTDLGS
FT                   FAGAVAYAKGSGTGSGTAVGGAFGVNVLSGATEAFIEDAVSLTANDLSIVADREGLNVA
FT                   IVAGVGIGMGQKGVGVAGSVSVNIALFTVEAALRDITGPVQVNTLSVTADDDSTLIAIA
FT                   GSVAFGGKAGVGIAMGFSWTETDVSALVSNVSNLTHTGDFTVDATADGLIVAVTGSVGI
FT                   SAGQAKGYAGAGTVSINFLKNTLEAKIVDTIVTAASTGDISVDADDSTGIYSFAGALAA
FT                   GKTAGLGAAIAVNSLDNSVTALVDGSTLETSGDFSATAEETGTVVTVAVAGAGSTKLAI
FT                   AGSVAINIFDNDITARVVDSAISANAVAFTAEDRSTSVAAAGGIAISTGQAGVGAAVGV
FT                   NLIFNNVTARVENSAIDAASAIDVSAGAETLLVSVTLGGAGGEKFALGGSFSANVVMNT
FT                   VTADIISGSTLDAAGDIGIAASDTTTAVIVAGGFAGSGKAAVGLSFSQLYMENQTTAVI
FT                   DDATVTSTGGSIGLAAGIAPPASKAELSDVRMMTYGVDLPDTNSSSIFNLTVAGAGAGK
FT                   VAAGFALSVNNINNTITAEIRNGSVVDGSAGVALSAIDASVIDAIALGVAGAGDVAVGG
FT                   AVSVNTITNTIGTAISESTVRAGVNATGTVLTNADAAVTLDSASSSIIRALAIGVSGSG
FT                   KVAVSVTALGNAVANDVSAEIIGSTVMAGGDISLTASDIAPALIPGMELAAEDQDRLDD
FT                   SLADSPVDPQGNILSLMISVAGSGKVAVSAALAGNVINNTVTTLVDDATVLAGINAVTG
FT                   DVINAAADVTMAALSKAGIVAVTVGVAGAGNVAVQATGFGNVITNTVASSIQGNATVSS
FT                   GHDFSLTAYDQSTIRSLAIGVAASGSAAVSALIGANVVTNTVTAQIAGSEASSGGALTV
FT                   DAQNSSAIYSFAGGVAASGSVAVQVSLAANVVANRTEASINDRTFDEDGDLVEGVTVAS
FT                   VVNAGGSLSVTADDTSSIDAIGIGVAGSGSVAVGVALSANVIANSILASVEGSTVDAGG
FT                   SVGLAAESEAIIRAIAIGVSGSGTVAVQVTAMGNVITNTVSATITDATVTAADNVTLEA
FT                   SDIAPSAIPEWMVSAEDMDSINGSLEDSPIDMDASILAINISVAGSGAVAVNGAFTGNV
FT                   ITNTVVSSIENATVTATAGEVILASDSKARIIAATVGVGASGAVAVNVTGFGNVIVNQV
FT                   EASITDGAVVTTGADVLLSAVDDSSISSIGLSVAGSGAVAVSVIVGANVITNHVTAGIN
FT                   DATVDSGGAIGLIASQEAAIFSFAGGVAATGAVSVQVSLAANVITNTTEASIVESTVDA
FT                   DGDVFLAASDSSSIDSFAFGVSGSGAVAVGVALSANVIANTVTASIEDATVTAGGAVSL
FT                   TATSEAIIRAVALGVSGSGAVAVQVTAMGNVVTNHVLATITDSTVTAVNDVTIEASDIA
FT                   PSAIPAWMVPADKMDEINESLEDSPIDLDANIVALNISVAGSGAVAVNGALTGNVIANT
FT                   VCADIDASTVRAGVDINDVVINTAAAVGLLASSRSRIISISVGVGGSGVVAVNATCFGN
FT                   VITNTVETSVKGGSVIKAGGNVDLDATDSSSISSIGLSVAGSGVVAVSVIAAANVITNT
FT                   TVAQIAGSTVEAGGNVTLDAIQNAVIYGFAGGVAASGVVSVQLSLAANVITNTTEASIT
FT                   DRVFNEDGSINEGASAPSTVTADGDVALLAKDSSSIDSVAFGVSGTGGVAVGAVLSANV
FT                   ITNDIATAVTGSTVAAGGAVSLDSESSAVIRSLNLGVSGSGAVAVTVNAMGNTVVNSVT
FT                   ADITDATVTAGTDVSLAASDMAPDTVSALNVPADREDEVTAAFDDTESPFGADSFTDAN
FT                   ILAMNISVSGSGLVAVDVNLTGNVIINTVLTTIDNSTVTATGGNLSMTAESRAVITSLS
FT                   LGVGASGAVSVGAVAFGNVITNTVESVIQNGATVTAGGALALAAADRSAIGSIGLSISA
FT                   SGGVAVSAIVGYNEIDNTISAKIDDATVESGGAMSLTALSDADIFSFSGGVAASGVVSA
FT                   QVSVSINTIENEVTAAVSDADITAGGLSLFARDLSTMDSVAIGVSASGFGAAGAAVSKN
FT                   LIDNSVQATITASTITAGAGGVSLTAESPALIRSFAAGIAGSGLAAGQASVTLNEITNT
FT                   ITAKIDDSDIHSTGTVSLLASDEAPDAIPDFLGDMMIPTGIIDTATDNLDGESVDQAAN
FT                   IVSFAATIALSGGVAGSAAVAENTITNTVVARVIDSDVTSTAGGITSEALSGSRISTLS
FT                   AGIGVAGGLALNASVSVNTIENTIQSSITGTGEISAHGTVGLTAVDDSRIDALTFSVAG
FT                   ALAAALGGAVVTNTVDNDVSAFIQGTSGTDKIQVFSAGQVSLLADARQIIGGRSIGATV
FT                   GAVAAGASVSVGTVSGSTKAYIGNYVEVGMAAGNTVGGITITAEADARVNSDTTAISAG
FT                   IGAGSGNDGRAIITSPVEAYISGTGTGVVVTDDIIVSATVRPKAVADTWGVNAGALAVG
FT                   VSLSEATVTSTVNAYVGGSITAGSLTVSAAQDLPPSGDSAKAEATGSGGALVGVDATVA
FT                   TATSDATVKGYVLANTTLNIAGATVISADTETRQRAEADSNVGGVVAVGVSSATASSDT
FT                   ETKAWLGSGVQLTGGSLSITATGHDDNLADTTAGAFGGIPVSSATAVTDNTSTTTAEIK
FT                   DGVVGRNIDLTSGGTGEFQIVADHTATFDSMVSAIAGGLFGGTGAEIDNTVTSTVDARV
FT                   GDSVNVTATDILMDAVNRARKNEDGTANIDGEAGGAIAGGGADSDTTIDFKTRVTIGNG
FT                   TSLAVTGDMASPGDFALRALNDLVVKDKINFFAAGGLSGLGAYSSIETLNDLARVTVGD
FT                   ADLISVGAINISARGTGDVSSVVNAQAYGAGTLILGDAVANVCPTNEVIINSGAHIQAL
FT                   GDLNISTGTNTNFVRDDYAVEATLDTFAGSAIPIEDVDASAYLFQENTITVASGALLET
FT                   ARSVSLHAEKYGFGEMTGRAKTVNWVSSIADALNGEAAEEMVGGTVRTESHAVVTVDGT
FT                   IRTGIMRSWSLTLDGWDRETGEITASGTVNGTDQKIGFTVTQEVLTSDLVNELMNAQSQ
FT                   LALYQDKGNATLITYYESEIARLEDLLREEGLLEGEDGEYAAVQQYVMTVNLDPVWAEA
FT                   GIIDIRADQLKGDGSFDAPGDASVTVLNHTPAFLRINGITIPEKNGGLFFNGLEMADNS
FT                   TINTINDNNADLDNQINDHEGNRLPTGWSAVVGGGAAFAAIPDNALSEPSVYVENDFVA
FT                   GTVAPDEIYPWPDIIVDGAVSNINGSATFKTLQAGDGNIVFNASVRAKDMTVIAGGTVY
FT                   IDGVSSYSVGGEAYSLWNSYTDEGTESATSSDINTILGMEPGDKVNLFGDKIFINAEYL
FT                   NINGVMQSGKEAYVLELDQDTIDEINSLSASQKGLVVLKTASQDDFIVRFDTTTRQIIV
FT                   DEMSVSGGHIELTGHILNTGAGEIRVLGGYATVEITNETAYDLVINRLDASQRGGGTLF
FT                   INDTATDLVTLYRMSGSEVIRTIDDGTTVQVDALVRTFDGTAYAPVDTYTPDDGWRYGW
FT                   TMLQQEGILYTSHVQKSAWLGIDALASDPAVENNKHSEPLGQPTITGTGPYFYKDTDIT
FT                   DDYTYLHTQQTIATEDWKLTDKRVDSTWYGEKTYHTWWKKEETVEHTYTHTISADRPFD
FT                   ITFLGHDQGQVTIDSHGDVVFQGPILNPSGTTRIETDGVIQQAGDSAYVNGLRVELDAE
FT                   KGIGSNTALNTNLADGPVYQYTSVYTGYPDDYADESKRGMTTLTTNDRVKLAADYAGGG
FT                   EPGAVYRYTGDPADRDLRVQDYSDTSLWEKVDHRPSLSAVTTSGKIQINEIIGDLFVDQ
FT                   VQTGHDAMGSGSNVALTAQGGIYVAQTPEGGWYTGLVQGGTIELTAGNGGIGNSASHPL
FT                   TLDSGTLLKDHVAISTVGDVYLKEVSGDLRLKKIDASGKNVYIEVANGSLLDVNQDATR
FT                   DERTYNELKDGVWSDLALTDSTGAQGKIDNIVLSFQMTRQQEYQTYWIYRNTQPDPSVY
FT                   DSNHTVTLSAADEAAYRAFYADLGKTEAEIDDAITTLENSRTTQYHTLHTQFDDYFSDR
FT                   GQAFPASYDSGFVYELSPDEESTLRGSVKVWTEEELLYAIGAGLLKPVSDTQATIEDPN
FT                   VVGADVTLITTGGVGNAGGRIVIDLTSGDFHLTSDERVAMAAAERDDVAYWGESATATV
FT                   KFVDAGTADQIVRTDGQTWTGFAEGDRIRVTGSTDNDDYYLITEVNGATITLSADDALV
FT                   NETGATVSFQHEVLDPLDTSLVKETITIDQKEDVDVEASGEINITAGGNVYLGSESNLN
FT                   LDTVRAGETVRIKGSQGIYNVALSGETNVISGDLVLEAAAASVGTGDNPITVNLNGEAT
FT                   TTARAGTDIYINSVGDTLYVGTMYARTGGVYLQADGSIVDGFNSYFENIRANVVILTAG
FT                   GGIGEPGDYLDVNILGTGTLTATAGGSIRIAETDGNMYVNRVTSSGGDVDLKAHQSILD
FT                   ANEDIAVDVTGNTISLTAEVGGIGVSGNDLDIDSAHSGPGVVNASSLLGNIYIIEPDGD
FT                   LSLGQVGTGDAYTAFITVPMGSIFNGLTGDGTNITSGKTYLVAKDHIGQEGASITTAVG
FT                   NLEGLATTGSVWIANLGALTVGGVVEEEKPGILSGGSVTVGAGSPVYLQESITAASGNI
FT                   TITSYDDNDDDGTYPCGLARTDDIYVPEGVFLNAEAGNVILRAGDDLFIDGTVSAAGDV
FT                   IMYIDFGNADPGVGGTVHISAVATVIGSQAFIYGDSDDDHFPMIEPLYDIAGAVTLTGF
FT                   GGSDLYEIELYGIGAALFNVYDESPAADLGNDSLRIYATDEADVFLFRPGAIISLEMDE
FT                   NRVPVENGVVERVNYNGDINAGVYVFGRDGDDTFVFDDTNSPVTVYGDAGDDTFQVGQM
FT                   FESPRAANAGLAPEDWFDTTLTTQGYLSNGISFPATMYGGVGEDTFTVYRNLAELSLYG
FT                   EEDNDTFIVRAFVKVDPNDPKAPFTNINGGQGADFISYTVNAPVNIEGGDGTDTLTVVG
FT                   TEFGDDFVVTDSGVYGAGLFVRYGGIEEVVVNALEGNDTFFIASTSEDVAVSLIGGLGS
FT                   DDFNVGGGTDGEPISVVSNDLLGHSGLIDLLVNSDLADSDYAGVFAQDVAVNVMDADAA
FT                   GVTVRLLEGSLRVFEDGTAPAGLVMAQYAVALTRPPEEDVRVTASATLPTEADIEAGGQ
FT                   GIALNGNEQGVTLLFDDSNWYVEQIITVTAPDDALTEGLRTYEIKHSVVQGRSAEDGDA
FT                   YDGLAVRSLTVEAVDNDAPGVVIAQQGNDTVVFEKEEIRASDKYTVVLTCAPETDVTIN
FT                   ISDLSGGQIDIVNAGGTAIDHLVFTVDNWDIPQDVYVRAVDEGVAEGTHFARIVHEIVT
FT                   TAGTNYDGVGVSQLDVRIIDGIPGVYVEQTGGSTDVVEPTDDVLLGVGQVSQPANVDDT
FT                   TIVADFGAAVINEAAGNNAFQMPQDLELGGWGINYSDEIGDREDNTSLTRPHITVQATG
FT                   DDTVDYFSFEVTQAMLDTAGGAVAVTLDIDHGFEADFVAGEYDSIWWISTLALTGPSGD
FT                   TVYGAISNPAWGQAGSSTFYDAYLETAVSEAGTYTIKVGDLLGLILGTGEGLPLGADYD
FT                   LHVSVEAHDVDTFTYEARPQFEDEKGNNTGQSIEDTDYWYTYFNPDIGDQENPAGGVID
FT                   SNTAYTSIIGDGDGSWDKYTFEVTQAMLLPGAGLVSGIADSSQYYLDAGIRLNGDVMAN
FT                   DVWTITINGQDYAYTVQDTDTTLADIISGLAGEINDLADDSADDYYSVTAALNSTDPAV
FT                   LDLSDPNGFIFNGLTQTVQAAGRVTQTLDTGGVYFTSADIVFDPAAVITAGDVWSAVIN
FT                   GTTVDYEVQTGDTLATVIDELVGDIDGTYAPERIGDATLRLTDATGFTLNFAQAGASPE
FT                   ATAVITGTVMDAEAESVSWQTVTLDLTGTPVYGQTWTLTFNGSADAAYTVDDGDTLADI
FT                   AAGLKADAPAGYTILANGRSVTVSRLNGDSFTVDLEITQSPADMPGVVDGDASYWSEAK
FT                   VVFAGPVNVGETWTMTLTDTSGAATVYSYDVQDGDDIDDVGDAFEDQIASASYRNRSNT
FT                   LTITEAGGVSVALDITAASTAQGTMTVSATNSIAALTAVDIDLSGTSLTTPPAEKWELT
FT                   LDGVTYEYSAGSDDTVDTVGQWFEDNEAIANAGFAVTYDDTTDTVSVSRTDTGVFTCGF
FT                   SVGGSGSATFDTTESTSHYAQAVFDLGGSAQVGEIWTLTLDGVDYTREISGLVYTVDNV
FT                   GQRFDWSSTISSAGFDVDYNTRTNRLTVTREDGRAFTASASVSPPPVTGTAVVDLDNSS
FT                   ASHYTRADIDLNRPVAAGETWELTVTQLDGTETTHTYVAGDETGDGTVDADDVGAWFAG
FT                   QLGAAASYDADTDTLTITDADGVQVAFSIIVNGSAVFSGTPDAGWSADIQINGSFAAED
FT                   QWSLTLDGTPYAPYTVDAADTGLDDVASGLGDIVDADYTVDVTGNTLHVTNADGSAVLV
FT                   NQVAQLRTVAGAQVAGGTQDGLEHWIDVTITLQKEGPLLEGELWAVTIHGVTYEYTVQE
FT                   TGETLAYVASQLKSVLEAAPELAGATISASSGVISITGLNGDTVDASRGNGTVLGIFDI
FT                   DYGSVLKNVLYEQTYITTDLPWGGSATFPGPLVPHDIMTSFYLRLVDVDSDEVLATSTY
FT                   ADWVDKGSTTPADPFLSYLFEEDGLYRIEVGTYADSLDGYVADMIRGVKKGLSYQLNVS
FT                   LQNHAVNPDVISLEGRTLTITEGAGAGQSFIIDGYDPATSTFTLDSALVAAVDRTSRFE
FT                   VSYDILDFTAYAETTDTFTVVLTAPPADGETVTVDVASVITRTYNSDLAFVDEANNGER
FT                   EDYQVYVNGVLSDVLTFDASNWYLPQDVTVTAIHDNVVDGSDAQIFPAMEERVAYIRGP
FT                   LTINGGEVTSEELILEAPYMLPGETNELIPDGDIESAGTNGSGKATLTDSDITHYDPQY
FT                   GQVGGFDPRMNDALYQVKILDGDLAGTIMDVESVDGNTITFVQDWPGGVAPAAGVHYYY
FT                   MPVNPNMRVNEADQVDTLNVFNGDSPSNDTGVLTADRLYGLGMGPDTVIAGEEVPGGIQ
FT                   YANLEVLNLELGYGSDTLTIESTHQGATTVSGGDGDDTITVRTIAGHTVVDTGDGADTV
FT                   WVGSDDGVADQINGLLTLVAGGDGDAVYIDDSQDASDNAGTLTQTTLTGLDMPSVADVQ
FT                   TVSVRAESGSYLLTTAGFGTAAGLADSANVTRTPDAATVTIDFDLYTDDTDLVRLRLEE
FT                   LYGVSGGIQVTETVDGFTKTYTIVFAGDLAGLDLPQLVWAETLDTTDLVVGDPDSSVDV
FT                   ETGTVQNGTTASLLNTVQALTVDAGADAGGTYRIGLRGFETVYNARRDWTDYVYTGNPD
FT                   LVVWTDPIAHDADAEAVYAALAPILNPNNSRDDLPWTHNVAVRKIDNVLFVTFQGEYGD
FT                   LEIAQEDIDTTGLTGTVDIGLDTRVNGINYYGVETLNIDLGAGNDRFNIKGTVPESRLN
FT                   LTLGAGDDTVNVYDDARSLDAIQAEVNIDFMAGTNTLNVDGSGDTAPDDSIIITNGSIT
FT                   GLAPGDINYQSTGGNMAGGITIWSGTGGDTIAVDSTHRTDGVRTITTLNTNEGNDSVTV
FT                   LLDADTDGFFVVNAQAGDDTVDGSASSRSLVIFGGDGADEIYGGSGDDIVFGDQGRVYY
FT                   RNETGEVVTSLGNGTPIAGNTVEVTSTWDFSANTDPLTSSRVIRLDGGAENGETWSVGI
FT                   KENGTTLVSVACTVVDDVAETPETIVAQLALLLEAELAAQGLAGYTVDAQGSNLIISNT
FT                   NGFLKFSVTHGVITEDRTDGVARTPVNIFTVDPGIGGMDTIDAGDGNETIFGGFGADTI
FT                   TAGAGDHVVMGDNGVVEYDTDGAPMVLETTDTAGHPEYGGDDTITITGDGNNHILGGMG
FT                   SDTIGTEATTAGTTDVILGDNGRVTYAGDTGALELSEIVSAETSTGGDDQITTGDGDKH
FT                   IFGGYGVDTITAGAGDHVVMGDNGVVEYDTDGAPLVLETTDTADHPEYGGDDTITITGD
FT                   GNNHILGGMGSDTIGTEATTAGTTDVILGDNGRVTYTGATGALEPSEIESTEISTGGDD
FT                   QITTGDGDKHIFGGYGVDTITAGAGDHVVMGDNGVVEYDIDGAPLILETTDTADHPEYG
FT                   GDDTITITGDGSNHILGGMGSDTIGTEATTAGTTDVVLGDNGRVTYDGPVGGLELSGIE
FT                   STEISTGGDDVITTGDGDKHIFGGYGVDTITAGAGDHVVMGDNGVVSYDTDGAPMVLET
FT                   TDTADHPEYGGDDTITITGDGSNHILGGMGSDTIGTEATTAGTTDVILGDNGRVTYDGP
FT                   VGGLELSGIESTEISTGGDDVITTGDGDKHIFGGFGIDTITAGAGDHVVMGDNGVVEYD
FT                   TDGAPRVLETTDTADHPEYGGDDTITITGDGNNHILGGMGSDTIGTEATTAGTTDVILG
FT                   DNGRVTYDGPVGGLELSGIESTEISTGGDDQITTGDGDKHIFGGFGIDTITAGAGDHVV
FT                   MGDNGVVAYDTDGTPRVLETTDTTDHPEYGGDDTITITGDGNNHILGGMGSDTIGTEAT
FT                   TAGTTDVILGDNGRVTYDGPVGGLELSGIESTEISTGGDDVITTGDGDKHIFGGFGIDT
FT                   ITAGAGDHVVMGDNGVVAHDTDGTPRVLETTDTTDHPEYGGDDTITITGDGSNHILGGM
FT                   GSDTIGTEATTAGTTDVILGDNGRVTYDGPVGGLELSGIESTEISTGGDDVITTGDGDK
FT                   HIFGGFGIDTITAGAGDHVVMGDNGVVEYDTDGAPRVLETTDTADHPEYGGDDTITITG
FT                   DGNNHILGGMGSDTIGTEATTAGTTDVILGDNGRVTYAGDTGALELSEIVSTEISTGGD
FT                   DVITTGDGDKHIFGGFGIDTITAGAGDHVVMGDNGVVAYDTDGTPRVLETTDTTDHPEY
FT                   GGDDTITITGDGNNHILGGMGSDTIGTEATTAGTTDVILGDNGRVTYDGPVGGLELSEI
FT                   VSTEISTGGDDEITTGDGDKHIFGGYGVDTITAGAGDHVVMGDNGVVEYDTDGAPKVLE
FT                   TTDTADHPEYGGDDVIDITGDGDNIVFGGMGSDHITTRNGTDVIFGDNGRTTYAGPVGG
FT                   LHLDRLESLLPTSGGPDTIATGNGTKYIIAGFGDDTAETGTGDDILIGDNGVVLYDTNG
FT                   LPALVYGTNPDVGGDDLLRTVDGTNIFIGGDGSDTMHGGAGRDAMFGDGGKATLEEGAW
FT                   RVLETIDPFIGGNDFIDGGPGRDVMMGGAGNNTFVGNLADDVMIDRYGRATFIPETQMA
FT                   VSVIRLDTISLIANVQEKLEGGSNIGEVPDVNVPLYGEARHGTDGLHRTGFGDGGKTAG
FT                   FTAAVTAASLHHHGDYEAIPLKTEPEEQLPEAAEEGKATGTDGRDVPPAKDALVPVSSM
FT                   PDHATIAATEAAGTAEEPSAGSGAVIAGIMGWKVLTGGAVAGRGAIDRQSFKDLAARQN
FT                   KKRFKRWTSVG"
     atgccgcgaa tcaaggtcgg tagcaaggca ggggagaagg acaaaaagaa aaaacgccgc        60
     gcagcccgca aggagcggcc ctttcagttc gaggccctgg aaccgcggtt gttgctttcc       120
     gcggagatgg gcattccccc ggcagaccct gagaacttga cggccacacc cgcgccggtg       180
     gtggaaaatg tggaccgctt caacgatgtg accactacgc ctgcggcaga cggtatcaag       240
     gatgacgggg aagtaaagac cgttgcggac aatggagaaa aagaagggcc cgccgctccg       300
     gaaaagccgg acccgtcgca tgcccttacc gcaaacgatg tcgtggatgc cgaacccgcc       360
     cccggcacaa cgcttttttc cgacacggtt gacaaaatta ccgcggaaag ggcattgcgt       420
     caggtggtgg tcattgaccc ggcggttgtg gataccaatc atctgctgac ggccattgac       480
     ggctcccggc aggatgcccg catcatcaat cttgccggca acgcggacct gccggcggat       540
     acgtccgccg gttccctgct ggatatctac cttcttgacg gcagccgtga tggcgtcgcc       600
     cagttgacgg acatactgga aaattacgac accctggacg cggtacatat tttttcccat       660
     ggcgataccg gcgcggtcta cctgggcacc acccctgtta ccggtgagaa cctggccgac       720
     cggcagaatg acctgaccgc ctggggggca gcgcttgcgc ctgatggaga ccttcttctt       780
     tacggatgtg atgtggccgc gggtgacgac ggtgtcgcct ttgtggagac actggccgct       840
     tttacagggg ctgacgtggc cgcctccacg gacaggaccg gccctgtcga cctggacgga       900
     aactgggacc tggaatttca gaccgggccg gtagagaccc ccgttctttc gaatgccaca       960
     accggctact cccatcttct ggagaccttt gtcagcaccg gtgacaacga gacctttgaa      1020
     ggcactggtg ccaacgacat cttcagcttt gacgacaact ggggcagcga taccatcgtc      1080
     aacggcggtg gcagcaatac cgttaatttt tcggcggtgt cggccgatct catcttcacc      1140
     ttccacgccg acggcaccgt gtcggccacg gacggtgaaa atgttctaaa ccccgccgag      1200
     ggcatcagta ccattattgc cggttccggc gacaaccgtt ttgtctttga acggggggcc      1260
     gtcttttccg gtaccatcaa tgcggccgcc ggcgccacca acaccctgga tttttcaggt      1320
     gtggcaccgg tgatcgaccc tgttgacgaa gatgcgccgg accgtaccgg tctggacctt      1380
     gtttttaccg ttcatgccgg cggcgcggtg tccgtgtccg ctgacggctc cgctatcctc      1440
     ggctccaccg cttccatgga tgcgattatt ggggggggcg gcgacaaccg ctttgccttt      1500
     gcagacggcg cggcctttgc cggctccatc gacggcggcg agggggggag caccaccctg      1560
     gattattctg cttatacatc ggcggttgcg gttgatttga ccgctggtac ggccacgggc      1620
     gttaccgggg gcatcagcaa tttttccaac atcgtgggcg gcgccggcaa cgacattctg      1680
     accggcgatg aatatgccaa cgagattacc ggcgggtcgg gcagtgatat catcgacggc      1740
     ggcatcgggg acgataccct gaccggcggc attggcaacg atgtcttccg gttttcagac      1800
     gactggggct ttgatgccat caccgacggc gatgtgggcg ccaataccct ggatttttca      1860
     aatgccaccg ccgacctgga ggtgatcttt gccgccgacg gcaccctttc cgttgatgac      1920
     tacaccagcc ttcttgaaac cggcgggagt gtagcggcca taaccaccgg caccggcgac      1980
     gacaattttg tgtttgaaaa tgcggctgcc ttcgacggca ccatcaccgg cgggacaggc      2040
     accaacaccc tggatttttc cgcctaccag acaccggtca ggatcgacct gggtgccggt      2100
     accgtggaca tgggcggttt tgtcaatgac gccggggtca tggaaggcat gacagcggac      2160
     atgcccctgg cctatctcaa cagcggtgat ggtgtgggcg tggcgggtat cacggacgaa      2220
     acccttctgg cggacctgaa cgacagcgcc ggggtgggct tgaccgttga attaaccacg      2280
     gccacgcttc tggccgatct taacaacggt gccggtgtgg ggatcgcccc cgcgctgatc      2340
     gccacgacac tgctggctga tctgcatgac ggcgccggaa tcggcgtagt ggacggcgat      2400
     gatatccaca ttaccctcac caacggtgac acggtcgata tcgaccttga cggctgtgca      2460
     accctggaag atgtgctgac cgccatttcc gccgccgatg cacgactggg cgcgacaatc      2520
     aacgccgacg gtaacggcat caatatcacc gacacggcag ggggcgccgg cgatctcgcg      2580
     gtctcgaccc tcaactattc gttggccgcg tcggacctgg gtattgaagg tgccggtacc      2640
     ggcaacctgc ttgaaggttc catgatcatc aacggcctgg gcattgtcct gaccgacggc      2700
     acacgggtga acgccgacct gtccggggcc gtcaccgtgg ccgatgtgct ggccgccatc      2760
     aatgccgccg gcggcggcaa gctctccgcc gaagtcaacg ccctgggcaa cggcatcaat      2820
     atcaccgaca cggcaggcgg agagggcgac ctgcgggtgg ccggcctggc cgattcaccg      2880
     gtggccgcaa acctgggcat tgacgggtac ggtcttgacg gtgtgctgga agggtcagcc      2940
     ctgatgcatg acctgcgcgt taccctgacc gacggcacag ccgtggacgt gtccctggcc      3000
     ggcgtcgaaa cggtgggcga cgtgctgacc gctttgaaca gtgttgatat cagcctctat      3060
     gccgttatca acgcggccgg caacggcttt gaactgtatg atgatgccgg cggggccggt      3120
     gacctggcgg tctcggccct caacgggggt actgccgctc ccggcctggg cattaccggc      3180
     accggtaccg gcgacaccct gaccggcaca actctggtat atgatatcag catcaccctg      3240
     accgacggta ccactgtaaa cgtggccctg ggcggcaccg ccaccgtggg agaggccctg      3300
     gcggccatta gcgcggcgca tcccgctctt tccgccgtca tcaacggcac gaacaacggc      3360
     atcaatattt ccgatacggc cggcggggcc ggcaacctga ccatcgcgga cctggggact      3420
     tccacggccg ccgctgattt gggcatcgcc ggaaccggcg ccggggcact ggttgccgga      3480
     acggtcctgg tcgctccggt ttctaccgcc cattttacag gcatcagcaa cgccgccggc      3540
     ggcgccggcg ccgacctgct tatcggcaac agccaggata atgtgttaga tggcggcggt      3600
     ggtggcgaca cctatcgttt tgccgccggc tggggcagcg ataagatcgt ggattacggt      3660
     accgacggca gcgacgtgct tgatttttct gcggttgcgt ccaatctggc cgtgaccgtt      3720
     catgctgacg gcacggtctc cgtgacagac ggtgccagta ccctggacaa cgccgacatc      3780
     attgaaggca ttgtcggcgg gtcgggcagc aacacttttg cctttgaaga ccaggccgat      3840
     tttgccgggt ttatcgacgg cggcaccggc accggcaata cactggatta ttcggcctac      3900
     accaccggcg tgacagtggg cctggccgat gttacggcca ccggcaccac gggtgtagac      3960
     aatatccaaa acatcaccgg cggcagcgga gacgacaccc tgaccggcga tgaccaggcc      4020
     aacaccatca ccggcggcga cggcaacgac accattaccg gtggcggcgg ggcggacacg      4080
     ctgtccggcg gggccgggga tgacacctat gtgatgacca atgacggcgc taccgtcacc      4140
     atcacggaag cagccgctgc cggcaccgac actctggact attcggagtg gggcgcgccc      4200
     gttacggtga acctgtccac cggcacggcc ccgggcacat ccggtgtaaa caacattgaa      4260
     caggccatcg gcacccgctt tgctgatacg cttgccggca ccaccgggga tgacaccttt      4320
     gtcttccatg atggctgggg taccgatacg gttacggacc cgaccgcgac tgacagcgac      4380
     acccttgatt tttcagccgt caccgcggcc ctgaccttta ccttcaccgg caccggcgcc      4440
     gtgtcggttt ccgatggtac aagtgcactc aacaacgtcg ctaacattga aaacctgacc      4500
     ggcggcaagg gagatgacca ttttgttttt gcggacaact ggggcaacta caccatcacc      4560
     tccgccggtg acgtggataa tgacacactc gatttttcgg ctgtcaccgc gaacctgaca      4620
     tttaccatcc atagcgacgg cacggtctcc gtcaccgacg gcaccaatac actgggcgct      4680
     tccggcggta tcgacaacat tgtcggcggg tccggtacca atacctttgt ctttgaagac      4740
     caggggtttc tgaacgcata tattgatggc ggcaccggca ccgccattct cgactattca      4800
     gcctgtacca cggcaattgc cgttgacgtc tccaacatgg acgtgaccgt gacccggacc      4860
     gtggacggcg cggctgtgac caccaccctg attggatccg cctcgggcct gaaaggtatc      4920
     aaccggatcg atgcggttat cggcgggacg tccgccggtg ataccctgac cggatttgag      4980
     gaggatacgg cctggaccct gtccggtgaa aatgccggtt cggttgccgg cggaaccaca      5040
     cttcgcaaca ttacattctc cggttttgaa aacctggccg gccatgccga tcatgatgac      5100
     acgtttacca ttcaggccgc cggatctctg gacggcgccc tgatcggcca tccctatggc      5160
     ccggccaccg gcaccgacac ggtgcgcatt gcaaacggcg cctacaccac tgtgaccctg      5220
     gccagtgccg gcgaagatgc cggctggatc gaccgggacg gtgaccagat ccggtatatc      5280
     ggcattgaca gggtggaaga cctttccacc gccaccaccc gcaccgttgc cagcgccgcg      5340
     gaccgcaccg ccgaggttta tctcgccggc gatccctacg aaaaggacca ggaatggatc      5400
     ctgaccgtgg acggcgtgga ttacgtgcat accgttgcca gtgacaacga agtgctggcc      5460
     gatgtcatcg ccgactgggt cggcctgctt cagggggccg ggtatgtggc cattgcccgg      5520
     aacagcaccc tgcaggtgac cggaccggcc gggaccacgc cggttgttac cgctaccctg      5580
     cccgatggaa ttttgtttct ggtggacgac ccggagaccc gcgacgccga tatccggctg      5640
     gagagagaca gcggcacggg ccggattacc gttgtcagtg gcagtgattc gtttgtcgat      5700
     tttgaatttg tcgagccgac cacaaatctg aacctggaga ccggcgcggg caacgaccgc      5760
     gtcaccgtgg gtaccgggtt ctcgcccacc acagccgcgg tgaccattga cggccaggcc      5820
     ggtgccgacc acgttgctta cgaggtgacg ggtattgccg gtacggccca gaccatcacc      5880
     cacgcggcca atacgctcag caacagcggc acggcgattt ttacctacac cgctgatacc      5940
     gagtatgcaa aagatattac tgttttcggt actgccggca acgaccagat ggccatggcg      6000
     gacggtgccg gcaccaccta tgtggtcagc agcaccaccg ccacctttgg tgatatcacc      6060
     cttgacgatc ccggcgccgg cgggatcctg accctcaacg gcggagatgg agacgacacc      6120
     attaccgtga acgtgaccgg tctggccgcc gacctggtgc ttcagggcgg gaaaggagac      6180
     aacaccgtca ccgccgtcaa cggcacgttt gccaccctga acctgggcgg ggattttacc      6240
     accatgaacg ccgccggcgc cacggtgacc gattttgttt ttgacgcccg cccgtcaatc      6300
     gccaaccggg tcaccgtctc ccgggtgggc gggcagattc agatcgtgga tgagaccgac      6360
     atcggtacca ccacgaccac catcaatgat cccaccgggt ccctgaccat taacacgggt      6420
     tacaacgcgc cggaaacaac agagtatatc catcttgggg cactgaccct ggacgccgac      6480
     ctgatcctgg atgccggcag cctgaaccgg aactcggacg gaggggacac ggtcctcatt      6540
     cagggcgatc ttgtcctggg cggccactcc ctggagatca aggccgacac gatcaccgtt      6600
     gaaagcggcg ttacggttaa taccggagac gcctccggca ccactgccgg caatatcacc      6660
     cttgagggcc acgacatcac cctggaaacc ggtgccagcc tgctggccgc cgacgatgtc      6720
     aatggcgaca tcaccattct ggcagtggac aacaccgccc ttttcgtgcc cctgatcgat      6780
     atcgatatca gtcatgtcag ctttaccatg aagagcgggg cggcgattga gggcggcaac      6840
     gtggagatca tcgcttccgc cagcaaccag caggtttttg aaaacaacga agagggattt      6900
     ggcggcaagg ccctgggcct tctggagagc gccctgggcg tggtggagga cctgaatttc      6960
     tttattaccg tcagctacgt ggaatccacc gccaagatcg acattcagga cggatcggtt      7020
     atcaccgctg agcagtttac cgcctatgcc aacacctatg ccgacgtcag ggccaagctc      7080
     atcaagtcct ggggcgtggg cggcgccgcc ggcgtggcca tcagcgaggc cagcgtcacc      7140
     cttgccggcg agctcaacgt cacgggcaat gtcaccctgc gttccctggc ggacatcacc      7200
     atggacgtgg tggccacacc ttctccggtc aagggcgtgg ccgtggccgt gggtatatcg      7260
     gtgatcgact ccgaatccac ggtgcatgtg accgatacgg cagagctcac catcggcggc      7320
     gatctttcca tgcgggccga gaccattgag cacagccgcg tgctggccca gtccaccagt      7380
     ggaaaagacg gggccgtggg cctggcgttt gccattaccg tggaacaggg cagcaccaac      7440
     gcctggatgg acggacaggc cgtgatcggc ggcgatgtac tggtctccgc cggcatggtg      7500
     caggagatga tcgaggtcaa gaagctttat tttctgccct ccaccaccat cggtaccggc      7560
     gcccaggccg gcgtgggcag caattccagc ggcgatgttc tggacgacgt gaagtcatcc      7620
     gcccagtccg ccattcttgc caaggtgatg agcccggttc agggcaagat cgacaaggtc      7680
     accaagtggt tcaagaccaa gctgggcatc agcgatgagc cttccaagga gccgcccttt      7740
     gacgtggccg gcgccgtctc ttttgtatat gacagcaatg aaacctcggc ccggatcggc      7800
     gacggcgacg acgccacatt tgacggcgcc cttgatgccg gcggctccgt gctggtgatc      7860
     agttccatcg cgtcatgccc ctatgtcagc gccaatgcgt cggccagcaa caacgactcc      7920
     acccagccgt caggcggcaa ggcggacagc aagttctccg gttcggccgc catctccatc      7980
     ggcatttaca aaaacgatgc cgaagcggtt atcaacgacg gggccgtggt ggatgccgtg      8040
     gacgatatca acgtctgcgc cgcggccttg aacgactatg tgtttgtctg gggcaggaat      8100
     ctctatgatg tctgggtcca ggaggctgat tacaccaccg atgacgccgg cccggtgacg      8160
     gtcctggagg gccagaccgt ggaagtgacc tccggttata ccggcaacgg tgaggagggc      8220
     acctggtaca agtatctcgg cgcggcagac ctgtccgttg atgactggtc aacggttgat      8280
     ttttcggacg aagccctctg ggaggggatc aatccgctgc acaagaaggg catggatttt      8340
     gtcaccaacc tgaccaccta tctgagcggg gatttcggca tgtcggcctg gctgggcaat      8400
     tcctggaccc aggccacggc cgagggtgac accctggcca ttgccggcgc cgtcacctat      8460
     ctggacatgg ccaacaacgc cgaggcggcc attcgaaagg acgcgcagat caaccagaat      8520
     gacggcggcg acgggttcgg cgacgtggtg gtccaggccg tcaacctcaa cgaaacagtc      8580
     aacctgggcg gcaacatcaa cctgccgggg atatcctcgg aaccggaaga aggaaagacg      8640
     cttcccaagc tgtcggccca gtacaaaccc aaggacctgc tcggcaccaa ggccgaggac      8700
     ggcaaggggg ctgtgggcgc cacggtcatg atttacaact ataaggacac caccgaggct      8760
     gttatcgaag acggcgtaat cctttccgcc gacagcctgc tggtggacgc ccagaccgga      8820
     accatgggtg tcaatgtggg ggcctcgggc ggccagggcg gcaaggttgg gttcaacggc      8880
     gtggtcatcg tcaatgtggt tgataacgaa accacggccc gtatcgatgc cggggccgac      8940
     attgccgtgg gcagcggcct ggtggtggat ggcgttgcct ttgatcctga ggatgccatc      9000
     agccttatcg gcgactggat cgatctcggg ggctattacg ggcttaaggc cggggactcg      9060
     ctcgtttatg acaacggcgg tggaaccagc atcggcgggc tgacccaggg agagacctac      9120
     tatgtggcgg ccgtgtccgg cacgaaaatt cggttggcgg acgcctcggg caacgccatc      9180
     ggcctggata aggattccgc caccggtgcc gatcacaacc tgaccggcat aaattccctg      9240
     gtggtcaacg cccgggacga tctttttctg gtggatgtgg ccggtggtgt ggcggtgtcc      9300
     agcgaggtcg gtatcggggc ctcagtcaat gtcaatatcg tcaatcggga tacccaggcc      9360
     cttatcggcg atttgcatga taccgatgcg gcggaccaga ctgccgtggg tgaccgcggg      9420
     acagtgacag tggcgggcaa caccgcggtc agcgccgtca atgacggttt tatcggcggt      9480
     ttttccgtgg ccggggccgt ggccaagagt tcccagaaag caccgggcag cggcggtggc      9540
     accagctcca accggggcac cggcggcacc cagggctctg atggcagcgt gacaagtaac      9600
     gacgccctgt cttcctggca gagcaagtgg gcctcggtcc ttggtgaggg caaagacaag      9660
     ggcaagcttt ccggtgatgt ggccggtgat acgtccaaat ccacagacca gaccgcccag      9720
     tccaagtcgg ggtttgccgt ttccggcgcg gtggtggtcg atgtggttga cgacaacgcc      9780
     cgggcctata tcttcaatgc cggagccgtg accttgacca gtgacggatc cctgagcgtt      9840
     tcggccggca atgacaccga tctgggttcc tttgccgggg ccgtggcata tgccaagggc      9900
     agcggcaccg gttccggcac cgccgtgggc ggcgcctttg gcgtcaatgt gctgtccggc      9960
     gccacggaag catttattga ggacgccgtc agcctgacgg cgaacgatct ttccattgtg     10020
     gcggaccgcg aaggcctgaa cgtggccatc gtggccggcg tcggtatcgg tatgggccag     10080
     aagggcgtgg gcgtggccgg atcggtcagt gttaatatcg ccctgttcac cgtggaagcg     10140
     gccctgcgcg atatcaccgg cccggtccag gtgaataccc tgtccgtcac cgctgatgac     10200
     gattccaccc tgatcgccat tgccggttca gtggcttttg gcggcaaggc cggggtaggc     10260
     attgccatgg ggttttcctg gacggaaacc gatgtgtccg ctctggtttc aaacgtcagc     10320
     aacctgaccc ataccggcga ttttaccgtt gacgccacgg ccgacggcct gatcgtggcg     10380
     gtcaccggtt cggtgggtat ttccgcgggc caggccaagg ggtatgccgg ggccggcacg     10440
     gtttccatca attttttgaa aaacaccctg gaagcgaaga ttgtcgacac gatcgtcacc     10500
     gccgcttcca caggcgacat tagcgttgac gccgacgaca gcaccggcat ttactctttt     10560
     gccggcgccc tggccgccgg caagaccgcc ggtctgggcg cggccattgc cgtaaactcg     10620
     ctggacaaca gcgtcaccgc cctggtcgat ggctcaactc tggagacttc cggcgatttt     10680
     tccgccacgg ccgaagaaac cggcaccgtg gtcaccgtgg ccgtggccgg ggccggttcg     10740
     acaaagctgg caattgccgg ttccgtggcc atcaatattt ttgacaacga tattacagcc     10800
     agggtggtcg acagcgccat ttccgccaac gccgtggcct ttaccgccga agaccggtcc     10860
     accagcgtgg ccgcggccgg cgggatcgcc atttccacgg gccaggccgg ggtcggcgcg     10920
     gccgtgggcg tgaacctgat cttcaacaac gtcacggccc gggtggaaaa ttcggccatt     10980
     gacgcagcat cggccattga cgtgagcgcc ggtgccgaaa cccttctggt cagtgttacc     11040
     ttgggcggcg ccgggggcga gaagttcgcc ctgggtgggt ctttttccgc caacgtggtc     11100
     atgaataccg ttaccgccga tattatcagc ggctcgacgc tggatgcggc cggagatatc     11160
     ggcattgcgg catccgacac caccacggcc gtgatcgtgg ccggcgggtt tgccggatcg     11220
     ggtaaggcgg ccgttggtct ttccttttcc cagctctata tggagaacca gaccacggcg     11280
     gtcattgacg acgctaccgt tacatccacc ggtggaagca tcggcctggc cgccggcatc     11340
     gcgccgccgg ccagcaaggc cgagctttcc gatgttcgca tgatgaccta cggtgtcgac     11400
     ctgcccgaca ccaacagctc ctcgattttt aacctgaccg tggccggggc cggggccgga     11460
     aaagtggccg ccggttttgc cctttccgtg aataacatca acaacaccat cacggcggaa     11520
     atccgaaacg gatccgtggt ggacggttct gccggcgtgg ccctgtcggc cattgacgcg     11580
     tccgttatcg atgccatcgc cctgggcgtg gccggtgccg gagacgtggc cgtgggcggg     11640
     gccgtttccg tgaacaccat caccaacacc atcggcacgg ctatcagcga gtcaaccgtt     11700
     cgggccggtg tcaacgccac tggcaccgtg ctgaccaatg ccgatgccgc cgtgaccctg     11760
     gattcggcgt catcatccat cattcgcgcc ctggccatcg gggtgtccgg ctccggcaag     11820
     gtggccgtgt ccgttacggc cctgggcaat gccgtggcca acgatgtttc cgctgagatc     11880
     atcggttcca cggtcatggc cggcggtgat atttcgctta cggcctccga tattgcgccg     11940
     gccctcattc ccggcatgga actcgccgcc gaggaccagg accggctgga tgacagcctg     12000
     gctgattcgc ccgttgaccc ccagggcaat atcctgtcct tgatgatcag cgtggccggt     12060
     tccggcaagg tggcggtcag cgccgccctg gcaggtaatg tgatcaacaa taccgtaacg     12120
     acccttgttg atgatgccac cgtgctggcc ggcatcaacg ccgttaccgg ggatgtgatc     12180
     aacgccgcgg cggatgtcac catggcggcc ctgtccaagg ccggcattgt ggccgttacc     12240
     gtgggcgtgg ccggcgccgg caacgtggcg gtccaggcca ccggttttgg taatgtgatt     12300
     accaacaccg tggcgtcgtc cattcagggc aatgcaacgg tctcttccgg ccatgatttt     12360
     tctctgacag cctacgatca atccacgatc cggtccctgg ccatcggcgt ggccgcctct     12420
     ggcagcgcgg cggtgtccgc cctgatcggt gccaacgttg tcaccaacac ggtgacggcc     12480
     cagatcgccg gatccgaagc gtccagcggt ggcgccctga ccgtggacgc ccagaacagt     12540
     tccgccattt acagctttgc cggcggcgtg gccgcctccg gctcggtggc ggttcaggta     12600
     agcctggccg ccaacgtggt ggccaaccgc acggaagcct ccatcaatga ccgcaccttt     12660
     gacgaagacg gtgatctggt ggaaggcgtg accgtggcgt ccgtcgtgaa tgccggtggc     12720
     tccctgtcgg ttacagcgga tgacacctcc agcatcgacg ccatcggcat cggcgtggcc     12780
     gggtccggct ccgtggccgt gggcgtggcc ctgtcggcca acgttattgc caacagcatc     12840
     cttgcctccg tcgaggggtc caccgtggac gccggcgggt ccgtgggcct ggccgctgaa     12900
     tccgaagcca ttatccgggc cattgccatc ggcgtgtccg gttccggcac cgtggccgtg     12960
     caggtcacgg ccatgggcaa cgtcatcacc aataccgtgt ccgcgaccat caccgatgcc     13020
     acggtgaccg cggctgataa cgtgaccctt gaagcgtccg atatcgcgcc cagcgccatt     13080
     cccgagtgga tggtttcagc cgaagacatg gacagcatca acggatccct ggaagattcg     13140
     cccattgata tggatgccag tattctggcg atcaatatca gcgtggccgg ctccggcgcc     13200
     gtggccgtca acggggcttt cacgggcaat gtcatcacca acaccgttgt ttcttccatt     13260
     gaaaacgcca cggtaactgc cacggccgga gaagtgattc tggcctcgga ttcaaaggcc     13320
     cgtattatcg ccgccaccgt gggagtgggg gcctcgggcg cggtggccgt gaatgtcacc     13380
     ggcttcggca acgtcattgt gaaccaggtg gaagcatcca tcacggacgg cgccgttgtg     13440
     accaccgggg cggatgtcct gctatcggct gtcgatgatt cttccatcag ttccatcggc     13500
     ctgtccgtgg ccggttccgg ggccgtggcg gtatcggtca tcgtcggcgc caacgtgatc     13560
     accaaccatg tcacggccgg gataaacgat gccaccgtgg acagcggcgg ggccatcggc     13620
     cttatcgctt cgcaggaagc cgccatcttc agctttgcgg gcggcgtggc ggcaaccgga     13680
     gcggtgtcgg tccaggtgag cctggccgcc aacgtgatta ccaataccac ggaagcgtcc     13740
     attgtcgaat ccaccgtcga cgctgatggc gatgtttttc tggccgcatc cgacagctcc     13800
     agtatcgact cttttgcctt tggcgtgtcc ggttccgggg ccgtggccgt gggcgtggcc     13860
     ctgtcggcca atgtcatcgc caacacggtg accgcttcta ttgaagacgc cactgtcacg     13920
     gccggcggcg cggtgagcct gaccgcgacc tctgaagcga tcattcgggc cgtggccctt     13980
     ggcgtatccg gttccggcgc cgtggccgtg caggtgacgg ccatgggcaa cgtggtgacc     14040
     aatcatgtcc tggccacgat taccgattcc acggtcacgg ccgtgaacga tgtcaccatc     14100
     gaagcgtccg atatcgcgcc cagtgccatt cccgcctgga tggtgccggc cgacaagatg     14160
     gacgagatca acgaatccct ggaagattcg cccatcgacc tggatgccaa tatcgtggcc     14220
     ctgaatatca gtgtggccgg ttccggggcc gtggccgtca acggggcact gaccggcaac     14280
     gtgattgcca atacggtttg cgcggatatc gacgcctcca cggtccgtgc gggcgttgat     14340
     atcaatgacg tggtcatcaa taccgccgct gccgtgggcc tgctggcctc ttcccggtcc     14400
     cggatcatct ccatatcggt gggcgtgggc ggctccgggg tggtggcggt caatgccacc     14460
     tgctttggca acgtgatcac caataccgtg gagacgtccg taaagggtgg ttcagtgata     14520
     aaggccggcg gcaatgtcga tcttgacgcc acggacagct cctccatcag ctccatcggc     14580
     ctgtccgtgg ccgggtcagg ggtggtggcg gtctccgtga tcgccgcggc caacgtgata     14640
     accaacacca cggtggccca gatcgccggt tccaccgtgg aagccggcgg caacgtgacc     14700
     cttgacgcca tacagaacgc tgttatctac ggttttgccg gcggtgtggc cgcctcgggc     14760
     gtggtcagcg tccagctctc cctggcggcc aacgtgatca ccaataccac cgaagcatcc     14820
     atcaccgacc gggtgtttaa cgaggacggc tcgataaatg aaggcgcgtc cgcgccgtca     14880
     acggtcaccg ccgatggcga cgttgccctg ctggcaaaag acagctccag tattgactct     14940
     gttgcctttg gcgtgtccgg taccggtggc gtggccgtgg gcgcggtgtt gtcagccaat     15000
     gtcatcacca acgacattgc cacggccgtt acaggttcca cggttgccgc cggcggggcg     15060
     gtaagcctgg attcagaatc ctcggccgtg atccggtccc tcaacctggg cgtgtccggt     15120
     tccggggccg tggccgtgac cgtcaatgcc atgggcaata ccgttgtcaa cagcgtgacc     15180
     gctgatatca ccgacgccac ggtaaccgcc ggaaccgacg tcagcctggc cgcttcggac     15240
     atggcgccgg acaccgtgtc ggcattgaac gttcccgccg acagggaaga tgaggtgacc     15300
     gctgcctttg atgataccga atcccccttt ggcgcggact cctttactga cgccaacatt     15360
     ctggcgatga acatcagcgt gtccggctcc ggcctggtgg ccgtggatgt aaatctcacc     15420
     ggcaacgtca ttatcaatac cgtgttgact actatcgaca actccacggt aacggccacc     15480
     ggcggcaatc tgagcatgac cgccgaatcc agggccgtga ttacttccct ttccctgggc     15540
     gtgggcgcgt ccggcgcggt ctctgtgggg gccgtggctt tcggtaacgt gatcaccaat     15600
     accgtggagt ctgtcattca aaacggcgcc acggtaacgg ccggcggtgc actggccctg     15660
     gccgcggcgg accgttccgc catcggctcc attggcctga gcatatcggc ttccggcggc     15720
     gtggccgtct ccgccattgt gggctacaac gagattgaca acaccatttc cgcaaaaatc     15780
     gacgacgcca ccgtggaaag cggcggggcc atgagcctga ccgccctgtc cgatgccgat     15840
     atcttcagtt tttccggcgg cgtggccgcc tccggcgtgg tgtcggccca ggtctccgtt     15900
     tccatcaaca ccatcgagaa cgaggtgacc gctgctgtca gcgatgccga tattacggcg     15960
     ggcgggctct ctcttttcgc ccgggatctg tccaccatgg attccgtggc catcggcgta     16020
     tcggcgtcgg gttttggcgc ggccggggcc gcggtttcca agaacctgat cgataacagc     16080
     gtgcaagcca cgattaccgc ttccacaata acggccggcg ccggcggcgt ttcgctgacc     16140
     gccgaatccc cggccctgat ccgctccttt gccgcgggta tcgccggttc agggctggcc     16200
     gccggccagg cctcggtgac gcttaacgag attaccaaca ccattacagc caaaatcgat     16260
     gattccgaca ttcactccac cggcacggtt tctctgctgg cctcggacga ggcgccggat     16320
     gcgatccccg attttctggg tgacatgatg atccccaccg gtatcattga tacggccacc     16380
     gacaacctcg atggcgagag cgtggatcag gccgccaata tcgtgtcttt tgccgctacc     16440
     atcgccttgt ccggcggtgt ggccggcagc gcggccgtgg cggagaacac cattaccaac     16500
     acagtggtgg cccgggtgat cgattccgac gtgacgtcaa ccgccggtgg tattacttcg     16560
     gaggccctgt cgggatcacg catttccacc ctgtcggcgg gtatcggcgt ggccggaggg     16620
     ctggccctga acgcctctgt atccgttaac accatagaaa acacgatcca atcctcgatc     16680
     accggcaccg gtgaaatttc ggcccatggc acggtgggcc tgaccgcggt cgatgattcc     16740
     cgtatcgacg cccttacctt cagtgtggcc ggcgccctgg ccgccgccct gggcggggcc     16800
     gtggtcacca acacggtgga caatgatgtg tccgccttta ttcaaggtac ttccggcacc     16860
     gataaaattc aggtattttc agccggccag gtgtcccttc tggccgatgc ccggcagatc     16920
     atcgggggcc gcagcatcgg cgccacagtg ggcgcggtgg ccgcgggcgc ttccgtgtcc     16980
     gtgggcacgg tgagcggttc caccaaagcc tatatcggca attatgtcga ggtgggcatg     17040
     gcggcgggca ataccgtggg ggggataacc attacagccg aggctgatgc gcgggtcaat     17100
     tccgatacca cagccatttc cgcgggtatc ggggcggggt cgggcaatga tggccgggcc     17160
     attatcacgt ccccggtgga ggcctatatc tccggtaccg gtacgggtgt ggttgtgacg     17220
     gacgatatca tcgtgagcgc gacggtccgg cccaaggccg tggccgatac ctggggtgtg     17280
     aacgccggtg ccctggccgt gggtgtttcc ctgtccgagg ccacggtgac ctctacggtg     17340
     aatgcctatg tgggcggcag catcaccgcc ggcagcctga cggtgagcgc ggcccaggat     17400
     ctgccgccaa gtggcgattc ggccaaggcc gaggccaccg gctctggcgg cgccctggtc     17460
     ggcgtggacg ccaccgtcgc caccgctacc agcgacgcca cagtgaaggg gtatgtgctg     17520
     gccaatacca ccctgaatat cgccggcgct actgttatta gtgccgatac cgagacccgg     17580
     cagcgggccg aggccgacag caacgtgggt ggcgtggtgg ctgtgggcgt aagcagtgcc     17640
     acggcctcgt ccgacaccga gacaaaagcc tggctgggca gcggggtcca gcttaccggc     17700
     ggcagcctga gcatcacggc caccggccat gacgataacc tggccgacac cacggccggt     17760
     gcctttggcg gcattcccgt gtcatcggcc acggctgtca ccgacaatac cagcaccacc     17820
     acggcggaga ttaaagacgg cgtggtcggc agaaatatcg acctgaccag cggcggcacc     17880
     ggcgaatttc agattgtggc cgaccatacc gccacctttg acagcatggt cagcgccatt     17940
     gccggcggcc ttttcggcgg caccggcgcg gaaatcgaca acaccgtcac ctccacggtg     18000
     gatgccaggg tgggggacag tgtgaatgtc acggccacag acattctcat ggacgcggtc     18060
     aaccgggccc gcaagaacga agacggcacg gccaatattg acggcgaggc cggcggcgcc     18120
     attgccggcg gcggggccga cagcgatacc accatcgatt tcaagacccg ggtaaccatc     18180
     ggcaatggca catccctggc ggtgacaggc gacatggcct caccgggtga ttttgcgctg     18240
     cgggccttaa acgacctggt ggtcaaggac aagattaatt ttttcgccgc cggcgggctc     18300
     tcgggcctgg gggcctactc cagcattgaa acgttaaacg acctggcccg ggtgaccgtg     18360
     ggcgacgccg atcttatcag cgtgggcgcc atcaatattt cggcccgggg caccggagat     18420
     gtctcttctg ttgtcaacgc tcaggcctat ggcgcgggga ccctgattct cggcgacgcc     18480
     gtggccaacg tctgccccac caacgaggtg atcatcaact ccggcgccca tattcaggca     18540
     ctgggggacc tcaacatctc caccggcacc aataccaatt ttgttcggga cgactacgcg     18600
     gtcgaagcca ccctggacac ctttgccggc agcgccattc ccattgagga tgtggacgcc     18660
     agtgcctatc tgttccagga aaacaccatc accgttgcgt ccggagcact gctggaaacc     18720
     gcccggagcg tcagccttca tgctgaaaaa tacgggttcg gcgagatgac gggccgggcc     18780
     aagaccgtta actgggtcag ttccatcgcg gacgccttaa acggggaggc cgccgaagag     18840
     atggtgggcg gcacggtccg tacggagagc cacgccgtgg tcaccgtcga cggcaccatc     18900
     cgcacgggaa tcatgcggag ctggtcattg acccttgacg gttgggatcg cgagaccgga     18960
     gaaattacgg ccagcggcac ggtcaacggc actgaccaga agatcgggtt tacggtcacc     19020
     caggaggtat tgacctccga cctggtgaac gaactgatga atgcccagtc ccagctggcg     19080
     ctttaccagg ataagggcaa tgccacgctt attacctatt acgagagcga gatcgcccgt     19140
     cttgaagacc tgctaaggga ggaggggctg ctggagggtg aagacggcga atacgccgcg     19200
     gtgcagcagt atgtgatgac cgtcaacctg gatccggtct gggccgaagc cggtatcatc     19260
     gatattcgcg ccgatcagct taaaggggat ggctcctttg acgcgccggg tgatgccagc     19320
     gtcaccgttc tcaaccatac accggccttt ctccggatca acggaatcac tattccggag     19380
     aaaaacggcg gactgttctt taacggcctg gagatggccg acaacagcac catcaacacc     19440
     atcaacgaca acaatgccga tctggacaac cagatcaatg atcatgaagg caatcgcctg     19500
     cccacggggt ggagtgcggt agtcggcggc ggggcggcat ttgccgccat tccggacaat     19560
     gccctgtccg agccgtctgt ttacgtggaa aacgattttg tggccggaac ggtcgccccg     19620
     gacgagatct atccatggcc ggacattatc gtggacggag cggtcagcaa cataaacggg     19680
     tcggctacct ttaaaaccct tcaggccggt gacgggaata ttgtttttaa tgcctcggtc     19740
     cgtgccaagg acatgaccgt gattgcgggc ggaacggtct atattgacgg ggtgtcctcc     19800
     tattcggtgg gcggtgaggc ctattccctc tggaacagtt acacggacga gggtaccgaa     19860
     tcggcgactt cgtctgacat caatacgatc ctgggcatgg agccgggcga caaggtcaac     19920
     cttttcgggg acaagatttt catcaacgcc gaatacctga acatcaacgg ggtcatgcag     19980
     agcggcaagg aggcctacgt tcttgagctg gatcaggata ccattgatga aatcaactct     20040
     ctctccgctt cccagaaggg gctggtagtc ttaaaaaccg cttcccagga cgattttatc     20100
     gtgcgtttcg ataccaccac gcggcagatc atcgtggatg agatgagtgt aagcggcggg     20160
     catatcgaac tgaccggtca tatcctgaac accggggcag gtgagatccg tgtcctgggc     20220
     gggtatgcca ccgtggagat caccaacgag accgcctatg acctggtgat caaccgcctg     20280
     gatgcctccc agcggggcgg cggcaccctt tttattaacg acacggccac ggacctggtg     20340
     accctgtacc ggatgtcggg cagtgaagtg atccgtacga tagatgatgg cacaacggtg     20400
     caggttgacg ctcttgttcg tacctttgac ggcaccgcct acgcgcctgt cgatacctat     20460
     acccccgacg acggctggcg ctacggctgg accatgcttc agcaggaagg cattttatat     20520
     accagccatg tgcagaagag cgcctggctg ggtattgacg cgctggcatc cgatccggcg     20580
     gtggagaaca ataagcattc cgagcccctg ggccagccga ccatcacagg aacggggccc     20640
     tatttttaca aggatacgga tattactgat gattacacct atctgcacac ccagcagacc     20700
     atcgccaccg aggactggaa gctgacagat aaacgggtgg acagcacctg gtacggtgag     20760
     aaaacctatc atacctggtg gaaaaaggaa gaaacagtag agcacaccta cactcacact     20820
     atttccgccg accgtccctt tgatattacc ttcctcggtc atgaccaggg ccaggttacc     20880
     atcgattccc acggggacgt cgttttccag gggccgatcc tgaacccttc gggcaccacc     20940
     cggattgaga ccgacggcgt gattcagcag gccggggaca gtgcttacgt gaatggcctt     21000
     cgtgtcgagc tggacgcgga aaaaggtatc ggcagcaaca cggcacttaa caccaacctg     21060
     gccgacggcc ccgtgtatca atatacctct gtttataccg gataccccga cgactacgcg     21120
     gacgagagca agcggggaat gaccaccctt accaccaatg accgggtaaa actggccgcg     21180
     gattatgccg gcggtggcga gccgggcgcg gtttaccggt ataccgggga tccggccgac     21240
     cgggatctgc gggtccagga ttacagcgac accagcctgt gggagaaggt cgaccatcgg     21300
     cccagtctca gcgctgttac cacgtccggg aaaattcaga tcaacgagat catcggcgac     21360
     ctgtttgtcg atcaggttca gaccggccac gatgccatgg gctcgggaag caatgtggcc     21420
     ctgacggccc agggcggtat ttatgtggcc cagacccctg aaggcggctg gtataccggc     21480
     ctggtgcagg gcggaacaat tgaactgacg gcgggaaacg gcggcatcgg caacagcgcc     21540
     agccatcccc ttacccttga ttccggcacc ctgctgaaag atcacgtggc gatttccacc     21600
     gtgggcgatg tttacctgaa ggaggtttcg ggggatctgc ggttaaagaa aatcgatgca     21660
     tcgggcaaga atgtctatat cgaggttgcc aatggttccc tgctggatgt caaccaggac     21720
     gcgacaaggg acgagcggac ctacaacgag ctgaaggatg gggtttggag cgaccttgcg     21780
     ctgaccgaca gcaccggggc ccagggcaag atcgacaata tcgtgctctc gtttcagatg     21840
     accaggcagc aggaatatca gacctactgg atctatcgta acacgcagcc cgatccttcc     21900
     gtctatgatt cgaatcatac tgtaaccctg tccgcggcgg acgaggccgc gtatcgggca     21960
     ttttacgccg acctgggaaa gacggaggcg gaaatcgacg acgccatcac cacactggaa     22020
     aacagccgca ccacccagta ccataccctg cacacccagt ttgacgacta tttttccgac     22080
     cggggacagg cattccccgc cagttacgat tcgggctttg tctatgaact gagccccgac     22140
     gaggagagca cccttcgcgg gagcgtcaag gtctggaccg aggaggaact gctttacgcc     22200
     atcggggccg ggctgctgaa gccggtctca gatacccagg ccactattga ggatcccaat     22260
     gtggtgggcg ctgatgtgac ccttatcacc acgggtggtg tgggcaacgc cggcgggcgg     22320
     atcgtcattg atctgaccag cggcgatttt cacctgacat ccgacgagcg ggtggccatg     22380
     gccgcggccg agcgggatga cgtggcctac tggggtgaat ccgccaccgc caccgtcaag     22440
     tttgtggatg ccggcaccgc ggaccagatc gtccggaccg acggccagac atggaccggt     22500
     tttgccgagg gcgaccggat tcgggtcacc ggcagtacgg ataatgatga ttactacctg     22560
     atcacggaag taaatggcgc tacgatcacc ctgagcgccg atgatgccct ggtcaacgag     22620
     accggtgcca ccgtgagctt tcagcacgag gtgctggatc ctctggacac ctccctggtc     22680
     aaggagacca tcaccatcga ccagaaggaa gacgtggacg tggaggcttc cggcgagatc     22740
     aacatcacgg ccggcggtaa cgtctacctg gggtcggaaa gcaacctcaa cctcgacacg     22800
     gtccgggccg gggagacggt ccgcatcaag ggcagccagg gcatttacaa tgtggccctt     22860
     tccggtgaga ccaacgtgat cagcggggac ctggtcctgg aagcggccgc ggcctccgtc     22920
     ggaaccggcg ataatcccat taccgtgaac ctgaacggcg aggccaccac cacggcccgg     22980
     gccggtacgg atatatatat caacagcgtc ggcgacaccc tctacgtggg gaccatgtat     23040
     gccaggaccg gcggggtgta cttgcaggcc gacggttcca tcgtggacgg gtttaattcc     23100
     tattttgaga acattcgggc caacgtggtg attcttaccg ccggcggcgg tatcggtgaa     23160
     ccgggcgact acctggatgt gaatatcctg ggaaccggga cgttgacggc cacggctggg     23220
     ggctctattc gaattgccga aaccgacggc aacatgtatg tcaatcgggt cacctccagc     23280
     gggggtgacg tagatctgaa ggcgcaccag tccattctgg acgccaatga agacatcgcg     23340
     gtggatgtga ccggcaacac catctctttg accgcggaag tcggcggcat cggcgtgtcg     23400
     ggcaacgacc tggacatcga cagcgcccac tccggtcccg gcgtggtgaa cgcatccagc     23460
     ctgctgggca atatttacat cattgaaccc gacggcgatc tttctctcgg gcaggtgggc     23520
     acaggagatg cctataccgc ttttataacc gtgcccatgg gcagtatctt caacggcctg     23580
     accggcgacg gcaccaacat cacctccggc aagacctacc tggtcgcaaa ggaccatatc     23640
     ggacaggagg gtgcgtccat aacaaccgcg gtcggcaacc tcgagggact ggccaccacc     23700
     ggcagtgtct ggatcgccaa cctcggcgcc ctgaccgtgg gcggcgttgt ggaggaggaa     23760
     aagccaggta tcctcagcgg cgggtcggtg accgtcggcg ccggcagccc ggtttacctg     23820
     caggaatcca tcaccgcggc aagcgggaac atcacaatca catcctatga cgataatgac     23880
     gatgatggca cctatccctg cggccttgcc aggacagacg acatctatgt cccggaaggt     23940
     gtattcctga atgccgaggc cggaaacgtc attctcaggg ccggggacga tctgtttatt     24000
     gacggtacag tgtcggcggc gggtgatgtc atcatgtata tcgattttgg caatgccgat     24060
     cccggcgtgg ggggcacggt ccacatctcc gccgttgcca ctgtcattgg cagccaggcc     24120
     tttatctacg gcgacagcga tgacgaccac tttccaatga ttgaaccgct gtatgacatt     24180
     gccggcgctg ttaccctgac cggtttcggc ggcagcgatc tgtatgaaat cgaactgtac     24240
     ggcattggcg cggccctgtt caatgtgtat gacgaaagcc ccgcggccga cctgggcaat     24300
     gacagcctgc ggatttacgc cacggatgag gccgatgttt tcctgttccg tcccggcgcc     24360
     atcatcagcc tggaaatgga cgaaaaccgg gtgccggtgg aaaacggcgt ggtggaacgg     24420
     gtcaactaca acggcgacat caatgccggg gtgtatgtat tcggccgcga cggggacgac     24480
     acctttgtgt ttgacgacac caattcacct gtcaccgtct acggagatgc cggagacgac     24540
     accttccagg tgggccagat gtttgagtcc ccccgggccg ccaatgccgg cctggcccct     24600
     gaagactggt ttgacaccac ccttaccacc caggggtatt tgtccaacgg catcagcttt     24660
     ccggcgacga tgtacggcgg tgtcggcgaa gacaccttca cggtttatcg caacctggcc     24720
     gagctttccc tttatgggga ggaggacaac gacaccttta tcgtccgggc gtttgtgaag     24780
     gtggatccca acgatcccaa ggcgcccttt accaatatca acggcggcca gggcgcggat     24840
     tttatctcct ataccgtcaa cgcgccggtc aacatcgaag ggggtgacgg caccgacacc     24900
     ctgaccgtgg tgggcaccga gtttggcgat gattttgtgg tgaccgacag cggcgtctac     24960
     ggcgccggtc tgtttgtccg gtacggcggt attgaagagg tggtggtcaa cgccctggaa     25020
     ggcaacgaca ccttttttat cgcctccacc agtgaagatg tggcggtatc ccttatcggc     25080
     ggtctgggca gtgatgactt taacgtgggc ggcggtaccg acggcgagcc gatttccgtg     25140
     gtgagcaatg acctcttggg ccacagcggc ctgatcgacc tgctggtaaa cagcgatctc     25200
     gccgattctg actatgccgg ggtttttgcc caggacgtgg ccgttaatgt gatggatgcc     25260
     gatgcagcgg gcgttacggt tcgtctgctg gagggctctt tgcgggtttt tgaggacgga     25320
     acggcacccg cgggcctggt catggcccag tatgccgtgg ccctgacgcg gccgccggaa     25380
     gaggatgttc gggttacggc cagcgccacg ctgcccacgg aggccgatat tgaagccggg     25440
     gggcagggca ttgccctgaa tggaaacgag cagggggtga cgctgctgtt tgacgacagc     25500
     aactggtatg ttgagcagat tatcaccgtc accgcaccgg acgacgcact gaccgagggg     25560
     ttgcggacct atgagatcaa gcacagcgtg gtccaggggc gctctgccga ggacggcgat     25620
     gcgtacgatg gcctggccgt acgcagcctg acggtggagg cggttgataa tgacgcgccc     25680
     ggtgtggtca ttgcccagca gggcaatgac acagtggtgt ttgaaaaaga agagattcgg     25740
     gcctctgata agtacacggt ggtgttgaca tgcgcgccgg aaaccgacgt aaccatcaat     25800
     atcagcgacc tgtccggcgg ccagatcgac attgtcaatg ccggcggcac ggcgattgat     25860
     cacctggttt tcacggtcga taactgggac attccgcagg atgtttatgt ccgggccgtg     25920
     gatgagggtg tggctgaggg cacccatttt gccaggatcg tccacgagat cgtcaccacg     25980
     gcgggcacaa actacgacgg cgtgggagtg tcgcagctgg atgtgaggat cattgatggt     26040
     attccagggg tatacgtgga gcagaccggc ggatccaccg atgtggtgga gcccaccgat     26100
     gacgtgctgc tgggggtcgg gcaggtcagc cagccggcga atgtcgatga cacgactatt     26160
     gtcgcggatt tcggagccgc cgtgatcaat gaagccgccg gcaacaacgc ctttcagatg     26220
     cctcaggatc tggagctggg aggatggggg atcaattaca gtgacgagat cggcgacagg     26280
     gaggacaata cttctttgac ccgcccccac atcacggttc aggcgaccgg agacgacacg     26340
     gtggactatt tttcctttga ggtcacccag gccatgcttg acaccgccgg tggtgccgtt     26400
     gccgtgaccc ttgatatcga ccatggtttc gaggccgatt ttgttgccgg ggaatacgat     26460
     tcgatctggt ggatttccac cctggccctt accggcccgt cgggcgatac cgtttacggc     26520
     gcgatcagca atcccgcctg ggggcaggcc ggcagcagca cgttctatga tgcctatctt     26580
     gagaccgcgg tgtctgaagc cggcacctac acgattaagg tgggagacct gctgggcctg     26640
     attctgggta ccggcgaagg gctccccttg ggagccgatt atgaccttca cgtatcggtg     26700
     gaagcccatg acgtggatac cttcacctat gaggcccggc ctcagttcga ggatgaaaag     26760
     ggcaacaata ccgggcagtc cattgaagat acggactact ggtacaccta ttttaacccc     26820
     gatatcgggg accaggaaaa cccggccggc ggcgtcatcg attccaacac cgcctacacc     26880
     tcgatcatcg gtgatggaga cggctcatgg gacaaatata cctttgaagt cacccaggcc     26940
     atgctgctcc cgggagccgg cctggtgagc ggcattgcgg acagcagcca gtattacctg     27000
     gatgccggca ttcggctcaa cggcgatgtg atggcaaacg atgtctggac catcacgatc     27060
     aacggtcagg attacgctta tacggttcag gatacggaca ccaccctggc cgatatcatc     27120
     agcggactgg ccggtgagat caatgacctg gccgatgatt ctgcggatga ctactacagc     27180
     gttaccgcgg ccctgaacag cacggacccg gcggtcctgg acctttcaga tcccaacggg     27240
     tttattttta acggattgac ccagacggtt caggcggccg gccgggtcac ccagaccctt     27300
     gataccggcg gcgtttattt tacctcggcc gatattgttt ttgacccggc cgctgtgatt     27360
     acggccggtg atgtctggtc agcagtgata aatggcacga ccgtcgatta cgaggtacaa     27420
     accggtgaca ccctggccac ggtgattgac gaactggtcg gcgacataga cgggacgtat     27480
     gcgccggagc ggattggcga cgccaccctg cggctgaccg atgccacggg ctttaccctg     27540
     aactttgcgc aggccggggc cagtccggaa gcaacggctg tgattaccgg aacagtgatg     27600
     gacgccgagg ccgaatccgt ttcctggcag acggttacgc tggatctgac cggtacgcct     27660
     gtttacggac agacatggac cctgaccttt aacggcagcg cggacgccgc gtacacggtg     27720
     gacgacggcg acacgcttgc ggatatcgcc gcggggctga aagcggacgc cccggccggc     27780
     tacacgatcc tggccaacgg ccgttctgta acggtgagcc ggctcaatgg cgacagtttt     27840
     accgtggacc tggagatcac ccagtccccg gcggacatgc ccggcgtggt ggacggagac     27900
     gccagctact ggtccgaggc aaaggtggtg tttgccgggc cggtgaatgt cggagaaacc     27960
     tggacaatga ccctgacgga caccagcggt gctgccactg tttattcgta cgatgttcag     28020
     gacggtgatg atatcgatga tgtcggagac gcctttgagg atcagattgc ctctgcctcc     28080
     tatagaaacc gcagcaacac cctgacgatt accgaggccg ggggtgtgag tgttgcgctg     28140
     gacattaccg cggcttcgac cgcccagggg accatgacgg taagcgctac gaacagcatt     28200
     gcggcgttga ccgccgtgga tatcgacctt tccggcactt ccctgaccac gcctcccgcg     28260
     gagaagtggg agctgaccct ggatggggtc acttatgaat attccgccgg ttccgacgac     28320
     accgtggata cggtggggca gtggtttgag gacaacgagg ccatcgcgaa tgcgggcttt     28380
     gcggttacct atgatgatac aacggatacg gtctcggttt ccaggacgga tacgggagtg     28440
     tttacctgcg gtttttccgt gggcggcagt ggttcggcca cattcgatac cactgaaagc     28500
     accagccatt atgcccaggc ggtcttcgac ctcggcgggt cggcccaggt cggtgagata     28560
     tggaccctga ccctggacgg tgtggattac acccgtgaga tcagtgggct cgtctatacc     28620
     gttgacaatg tggggcagcg gtttgactgg agctcgacga tttcttccgc ggggtttgat     28680
     gtcgactaca acacgcggac caacaggctt accgtgacgc gggaagacgg ccgggccttt     28740
     accgcctcgg cgtcggtaag tccgccgccg gtgaccggca cggcagttgt ggatctggac     28800
     aacagcagcg ccagccatta cacccgggcc gacatcgacc tgaacaggcc ggttgccgcc     28860
     ggagagacct gggaattaac ggtgacgcag ttggacggca ccgaaaccac ccacacttat     28920
     gtggcgggcg atgagacggg tgacggcacc gttgacgccg atgatgtagg cgcctggttt     28980
     gccggtcagc tgggagccgc cgcctcttat gacgctgata cagacaccct gacgatcacg     29040
     gatgctgacg gggtacaggt cgctttttcg attattgtta acggcagtgc cgtgttcagc     29100
     ggcacgcccg atgccggctg gagcgccgat attcagatca acgggtcgtt cgcggccgaa     29160
     gatcagtggt ctctgaccct tgacggcacc ccttacgcac cttacacggt tgatgccgcc     29220
     gataccggcc tggatgatgt ggcaagcggg ctgggcgata tcgtggacgc cgattatacc     29280
     gttgacgtga ccggtaacac cctgcatgtg acaaacgccg atgggtcggc tgttctggtg     29340
     aaccaggtgg cgcagctaag gacggtcgcc ggtgcgcagg tggccggcgg cacgcaggac     29400
     ggcctggaac actggatcga tgtcactatc accctgcaga aggaaggccc gctgcttgag     29460
     ggcgaactgt gggccgtgac gattcacggc gttacctatg aatataccgt ccaggaaacc     29520
     ggggagacac tggcgtatgt ggcctctcaa ttgaagtccg tcctggaggc cgccccggaa     29580
     ctggccggcg ccaccattag cgccagcagc ggggtaattt ccatcaccgg gctcaatggc     29640
     gacacggttg atgcatcccg ggggaacggc acggtgctgg ggattttcga cattgattac     29700
     gggagtgtgc tcaaaaacgt tctctatgag cagacgtata tcaccactga tctgccctgg     29760
     ggtggttccg caacgtttcc ggggccgctt gttccccatg atatcatgac cagtttttat     29820
     ctccggctgg tggatgttga cagtgacgag gtgctggcca cgagcaccta tgccgactgg     29880
     gtggacaagg gcagcaccac ccctgcggac ccgtttcttt cttacctgtt tgaagaggac     29940
     ggtctttacc ggatcgaggt gggtacttac gccgactccc tggacggtta tgtggccgac     30000
     atgatccgcg gggtgaagaa ggggctttcc taccagctca acgtgtcttt gcagaaccac     30060
     gcggtcaatc cggacgtgat cagcctggaa ggcaggaccc tgacgatcac cgaaggggcg     30120
     ggagcgggcc agtcctttat tatcgatggt tatgacccgg caaccagcac gtttaccctg     30180
     gacagcgcgc ttgttgcagc ggtggaccgt accagccggt tcgaggtctc atacgacatt     30240
     ctggatttta ctgcgtatgc cgaaaccacg gacaccttca cagtggtact gacggcaccg     30300
     ccggcggatg gggaaacagt cacggtggat gtggcctccg ttattacccg gacctacaac     30360
     tcggacctgg cctttgtgga cgaggcgaac aacggggagc gggaggacta tcaggtttat     30420
     gtaaacggtg tcctgagtga cgttctgaca tttgacgcaa gtaactggta cctcccgcag     30480
     gatgtgaccg ttacggccat tcacgacaac gtggtggacg gcagcgacgc ccagatcttc     30540
     ccggccatgg aagagcgggt ggcctatatt cgcggaccgc tcaccattaa cggtggcgag     30600
     gtgaccagcg aggaactgat cctggaagca ccctacatgc tgccgggcga aaccaacgag     30660
     ctgataccgg acggcgatat cgagtccgcc ggtaccaacg gcagtggaaa agccacgctg     30720
     acggatagcg atatcaccca ttatgacccc cagtacgggc aggtgggcgg atttgatcca     30780
     cgaatgaacg acgccctcta ccaggtgaag attcttgacg gcgatctggc cggcaccatc     30840
     atggacgtgg aatcggtgga cgggaacacc attacgtttg ttcaggactg gcccggcggc     30900
     gtggccccgg cagccggggt ccattattac tacatgccgg tcaatcccaa catgcgggtg     30960
     aatgaggccg accaggtcga taccctgaat gtgttcaacg gtgacagccc gtcgaacgac     31020
     acgggcgtgt taacagcgga ccggctttac ggcctgggca tgggaccgga cacggtcatt     31080
     gccggcgagg aagtgcccgg cggcattcag tatgccaacc tggaggtgtt gaacctggag     31140
     ctggggtacg gcagcgacac cctgaccatt gagtcgaccc accagggcgc taccacggtt     31200
     tccggcggtg acggagacga caccatcacc gtcagaacca tcgccggcca caccgttgtg     31260
     gataccggcg acggtgcgga caccgtctgg gtcggcagtg acgacggggt ggcagaccag     31320
     atcaacggtc tgctgaccct cgtggccggt ggagacgggg acgccgttta tatcgacgac     31380
     agccaggatg ccagcgacaa tgccggcacc ctgacccaga ccaccctgac cggactggat     31440
     atgccctcgg tggcggatgt tcagactgtc agcgtgcgtg ccgagagcgg cagctacctt     31500
     ctgaccacgg ccggcttcgg gaccgccgcc ggtctggcgg attcggccaa tgttacgcgg     31560
     acccccgatg cggctacggt gaccattgat tttgatctgt atactgatga taccgacctg     31620
     gtccgcctgc ggctggagga actctacggg gtgtccggcg gtatccaggt gacggaaacg     31680
     gttgatggct tcaccaagac atacaccatt gtgtttgccg gggatctggc agggctcgat     31740
     ctgccccagc tggtctgggc cgagaccctg gataccacgg acctggttgt gggagatccg     31800
     gacagctcag tcgatgtgga aaccgggacg gttcaaaacg gcaccacggc ttccctgctt     31860
     aataccgttc aggcgctgac cgtggatgcc ggtgctgatg ccggcggcac ctaccggatc     31920
     ggtctgcgcg ggtttgaaac ggtctacaat gcgagacggg actggacaga ttacgtttac     31980
     acggggaatc cggacctggt cgtgtggacc gaccccatcg cccacgacgc cgatgccgag     32040
     gcggtgtacg ccgccctggc cccgatcctg aatccgaaca acagccgtga cgacctgcca     32100
     tggacccata acgtggcggt ccgcaagatt gataatgtgc tgtttgttac cttccagggt     32160
     gaatatggcg acctggagat cgcacaggaa gatatcgata ccaccggcct gaccggcacg     32220
     gtggatatcg gactggatac gcgcgtcaat ggaatcaact attacggcgt ggaaaccctg     32280
     aacattgacc tgggcgccgg caacgaccgg ttcaatatca aaggcacggt gccggaaagc     32340
     cggctcaacc ttaccctggg cgccggagat gatacggtca atgtgtatga cgatgcccgg     32400
     tccctggacg cgattcaggc cgaggtcaac atcgacttca tggccggcac caacaccctg     32460
     aacgtggacg gctcaggtga tacggcaccg gatgacagta tcattattac caatggttct     32520
     attaccggcc tggcgccggg ggatatcaat taccagagca ccggcggcaa catggccggg     32580
     ggcataacga tctggagcgg caccggcgga gacaccatag cggttgacag tacccatcgc     32640
     accgacggcg tgcggaccat aaccaccctg aacaccaacg aggggaatga cagcgtcacg     32700
     gttttgcttg atgccgatac ggacggattc tttgtggtca atgcgcaggc cggggatgat     32760
     accgtggacg gttctgcctc cagccggtcc ctggtaattt ttggcggaga cggcgcggat     32820
     gaaatttacg ggggcagcgg tgatgacatt gtctttggcg accagggccg ggtctactat     32880
     cgaaatgaaa ccggcgaagt ggtcacttcc cttggcaatg gtacgccgat tgcgggcaat     32940
     acggttgaag taacgtctac ctgggatttt tcggcaaaca cggacccgct gaccagttcc     33000
     cgggtaatcc gcctggacgg cggcgctgaa aacggcgaaa catggtccgt tggtataaaa     33060
     gagaacggca caaccctggt ctcggttgcc tgcacggttg tcgatgacgt ggctgagacc     33120
     cctgaaacca ttgttgcaca gcttgccctg ctgctggagg ctgaactggc cgcccagggc     33180
     cttgccggtt atacggttga tgcccagggc agcaacctga tcatcagcaa caccaacggg     33240
     tttttgaagt tttcggtgac ccatggtgtt atcacggaag atcggaccga cggcgtggcc     33300
     cggacgcctg tgaatatttt cacggttgat ccgggtatcg gcggcatgga tacgattgat     33360
     gccggtgacg gtaatgaaac catttttggc gggttcggcg cggatacgat cacagccggt     33420
     gccggggacc acgtggtaat gggcgataac ggcgttgttg aatacgacac cgacggcgcg     33480
     cccatggtgc ttgagactac ggacacggcc ggccatcccg aatacggcgg ggacgatacc     33540
     atcaccatca ccggtgacgg gaacaaccat attctgggcg gcatgggcag cgacaccatt     33600
     ggcacggaag ccaccaccgc cgggaccacg gacgtgatcc tgggtgacaa cggccgggtg     33660
     acctacgcgg gcgataccgg cgcactggaa ctgtctgaga tcgtgtccgc cgagacctcc     33720
     accggcggag acgatcagat caccaccggc gacggtgaca agcacatctt cggcggttat     33780
     ggagtcgata cgatcacggc cggagccgga gaccatgtgg taatgggcga caacggcgtt     33840
     gttgaatacg acaccgacgg cgcacccctg gtgcttgaga ccacggacac ggccgatcat     33900
     cccgagtacg gcggggatga caccatcacc atcaccggcg acgggaacaa ccatattctg     33960
     ggcggcatgg gcagcgacac cattggaacg gaagccacca ccgccggcac cacggatgtg     34020
     atcctgggcg acaacggccg ggtgacctac acgggcgcaa ccggcgcact ggagccgtct     34080
     gagattgagt ccaccgagat atccaccggc ggagacgatc agatcaccac cggcgatgga     34140
     gacaagcaca ttttcggcgg ttatggagtc gatacgatca cggccggggc cggagaccat     34200
     gtggtaatgg gcgacaacgg cgttgttgaa tacgacatcg acggcgcgcc cctgattctt     34260
     gagaccacgg atacggctga ccatcccgag tacggcgggg atgacaccat cactattacc     34320
     ggtgacggaa gcaaccatat cctgggcggc atgggcagcg acaccattgg aacggaagcc     34380
     accactgccg gcaccacgga cgtggtcctt ggcgacaacg gccgggtgac ctacgacggt     34440
     cctgtaggcg gtcttgagct ctccggtatt gagtccaccg agatatccac cggcggagac     34500
     gatgtgatca ccaccggcga cggtgacaag cacatcttcg gcggttatgg agtcgatacg     34560
     atcactgccg gtgccgggga tcacgtggta atgggtgaca acggcgttgt gtcatacgac     34620
     accgacggcg cacccatggt gcttgagacc acggatacgg ctgaccatcc cgagtacggc     34680
     ggggatgaca ccatcactat taccggtgac ggaagcaacc atatcctggg cggcatgggc     34740
     agcgacacca ttggcacgga agccaccact gccggcacca cggacgtgat ccttggcgac     34800
     aacggccggg tgacctacga cggtcctgtg ggcggtcttg agctctccgg tattgagtcc     34860
     accgagatat ccaccggcgg agacgatgtg atcaccaccg gcgatggaga caagcacatt     34920
     ttcggcgggt tcggcattga tacgatcact gccggcgccg gggatcacgt ggtaatgggt     34980
     gacaacggcg ttgttgaata cgacaccgac ggcgcgccca gagttcttga gaccacggat     35040
     acggctgacc atcccgagta cggcggggat gacaccatca ccatcaccgg cgacgggaac     35100
     aaccatatcc tgggcggcat gggcagcgac accattggaa cggaagccac cactgccggc     35160
     accacggacg tgatccttgg cgacaacggc cgggtgacct acgacggtcc tgtgggcggt     35220
     cttgagctct ccggtattga gtccaccgag atatccaccg gcggagacga tcagatcacc     35280
     accggcgatg gagacaagca cattttcggc gggttcggca ttgatacgat cactgccggc     35340
     gccggggacc acgtggtaat gggcgacaac ggcgttgtgg catacgacac cgacggcacg     35400
     cccagagtcc ttgagaccac ggacacgacc gaccatcccg agtacggcgg ggacgatacc     35460
     atcactatta ccggtgacgg gaacaaccat attctgggcg gtatgggcag cgataccatc     35520
     ggcacggaag ccaccaccgc cgggaccacg gacgtgatcc ttggcgacaa cggccgggtg     35580
     acctacgacg gtcctgtagg cggtcttgag ctctccggta ttgagtccac cgagatatcc     35640
     accggcggag acgatgtgat caccaccggc gatggagaca agcacatttt cggcgggttc     35700
     ggcattgata cgatcacggc cggcgccgga gaccacgtgg taatgggcga caacggcgtt     35760
     gtggcacacg acaccgacgg cacgcccaga gtccttgaga ccacggacac gaccgaccat     35820
     cccgagtacg gcggggacga taccatcacc attaccggtg acggaagcaa ccatatcctg     35880
     ggcggcatgg gcagcgacac cattggcacg gaagccacca ctgccggcac cacggacgtg     35940
     atccttggcg acaacggccg ggtgacctac gacggtcctg tgggcggtct tgagctctcc     36000
     ggtattgagt ccaccgagat atccaccggc ggagacgatg tgatcaccac cggcgatgga     36060
     gacaagcaca ttttcggcgg gttcggcatt gatacgatca ctgccggcgc cggggatcac     36120
     gtggtaatgg gtgacaacgg cgttgttgaa tacgacaccg acggcgcgcc cagagttctt     36180
     gagaccacgg atacggctga ccatcccgag tacggcgggg atgacaccat caccatcacc     36240
     ggcgacggga acaaccatat cctgggcggc atgggcagcg acaccatcgg cacggaagcc     36300
     accaccgccg gcaccacgga cgtgatcctg ggtgacaacg gccgggtgac ctacgcgggc     36360
     gataccggcg cactggaact gtctgagatc gtgtccaccg agatatccac cggcggagac     36420
     gatgtgatca ccaccggcga tggagacaag cacattttcg gcgggttcgg cattgatacg     36480
     atcacggccg gcgccgggga ccacgtggta atgggcgaca acggcgttgt ggcatacgac     36540
     accgacggca cgcccagagt ccttgagacc acggacacga ccgaccatcc cgagtacggc     36600
     ggggacgata ccatcactat taccggtgac gggaacaacc atattctggg cggtatgggc     36660
     agcgatacca tcggcacgga agccaccacc gccggcacca cggacgtgat tcttggtgac     36720
     aacggccggg tgacctacga cggtcctgtt ggcggcctgg aactgtctga gatcgtgtcc     36780
     accgagatct ccaccggcgg agacgatgag atcaccaccg gcgacggtga caagcacatc     36840
     ttcggcggtt atggagtcga tacgatcaca gccggcgccg gggaccacgt ggtaatgggt     36900
     gacaacggcg ttgttgaata cgacaccgac ggcgcgccca aggttcttga gaccacggac     36960
     acggccgacc atcccgaata cggcggggat gatgtgatcg acatcaccgg ggacggcgac     37020
     aatattgttt ttggcggcat ggggtctgac cacattacga cccgtaacgg tacggacgtc     37080
     atctttggag acaacggccg gaccacctat gccggcccgg taggcgggct gcacctggat     37140
     cgtcttgaaa gcctgctgcc aacctccggc ggtccggaca ccattgcaac cgggaacgga     37200
     accaaataca ttattgccgg attcggtgac gatacggcgg aaaccggcac cggcgatgat     37260
     atcctgatcg gcgataacgg tgtggtgctt tatgacacca acggccttcc cgcactggta     37320
     tatggcacga atcccgacgt cggcggcgac gatctgctgc gcaccgttga cggtaccaat     37380
     atttttatcg gcggtgatgg cagtgatacc atgcatggcg gcgcgggccg ggatgccatg     37440
     ttcggggacg gcggcaaggc aaccctggag gaaggggcct ggcgcgtgct tgaaaccatt     37500
     gatcccttta tcggcggcaa cgattttatt gacggcggcc cgggcaggga tgtcatgatg     37560
     ggcggtgccg ggaataacac gttcgtgggc aacctggccg atgacgtgat gatcgatcgt     37620
     tacggccggg ccacttttat tccggagaca cagatggcgg tttccgtgat ccggctggac     37680
     accatcagcc tgatcgccaa tgttcaggag aagctggaag gcggcagcaa tatcggggag     37740
     gtaccggatg tcaatgttcc gctttacggg gaagcccgcc atggaacaga cggtctgcac     37800
     cggacgggct ttggggacgg cggcaagaca gccggtttta cagcggcggt gacggctgcg     37860
     tccctgcatc atcacggaga ctacgaagcg atacccctga agacggaacc ggaagagcag     37920
     cttcccgaag cggctgaaga aggaaaggcg accggcaccg acgggcgtga cgttccgccg     37980
     gcaaaggatg cgctggttcc ggtatcaagt atgccggacc atgccacgat agccgcaacc     38040
     gaagccgccg gcactgccga ggagccttca gccggttccg gcgctgtgat tgccggtatc     38100
     atgggatgga aggtgttgac cggtggcgcg gtggcgggca ggggggccat tgaccggcag     38160
     tccttcaaag acctggcggc acggcagaac aagaaacggt tcaaacggtg gaccagcgtg     38220
     gggtaa                                                                38226
//

If you have problems or comments...

PBIL Back to PBIL home page