(data stored in ACNUC7421 zone)

EMBL: CP000859.PE62

CP000859.PE62        Location/Qualifiers
FT   CDS_pept        complement(68641..69801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0062"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   mac:MA0859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65872"
FT                   /db_xref="GOA:A8ZRV5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV5"
FT                   /protein_id="ABW65872.1"
FT                   /translation="MSLMQVGYYLKKRQIPPLALIPDPILDTLAGVSSFRGRFQTLTGI
FT                   ERALTAFRHKEPDHVPVSPILCAGARQISGITFPDYALDGEKAAKVFMDGYNFVGGDAV
FT                   VLLLDLSVEAADFGQAIIYPLNSTPMPDYKNPVITHHDQYRALKSIRFSEAKRMQEFVK
FT                   LCRIVVEEVGLRAIVSGFVFGPLGILAMMRGAENLFKECRLYPKEVMAACDTITEVLVE
FT                   FVLAQCEAGVPAIAIDTLFASRSGLPKDLWEEIEGPFAGEISRAIKSTGRIVAIHNCGD
FT                   APYFDAQIRSMDPALINFSELPDDCASRREMKEKYGDRITLMGHVPTPLLVHGSPQEVI
FT                   DECRRHIDDLAPGGGYILSPGCEYPPNISLVNAFALIHAAKTHGRK"
     atgagcctga tgcaagtggg ctactatctg aaaaaacggc aaatcccccc cctggccctg        60
     attcctgacc ccattttgga caccctggcc ggggtctcca gttttcgggg ccggtttcag       120
     accctgaccg ggattgagcg ggccctgacc gcgtttcgcc acaaggagcc ggaccatgtg       180
     ccggtttcac ccatcttgtg cgccggtgcc cggcagatat cgggcatcac ctttcccgac       240
     tacgcgctgg acggggaaaa ggcggccaaa gtttttatgg acgggtacaa ttttgtgggc       300
     ggcgacgccg ttgtgctgct gctggacctc tccgttgagg ccgccgactt cggccaggcc       360
     attatctacc cactcaactc cacgcccatg ccggactaca agaaccctgt gatcacccac       420
     cacgaccagt accgggcact taagtccatt cggttttccg aggcaaaacg gatgcaggag       480
     tttgtaaaac tctgccgtat cgtggtggaa gaggtgggcc tgcgggccat tgtatccggg       540
     tttgtgttcg gccccttagg cattctggcc atgatgcggg gcgcggaaaa cctgttcaag       600
     gagtgccgcc tctatccaaa agaggtgatg gccgcctgcg acaccatcac cgaagtgttg       660
     gtcgagtttg tgctggccca gtgtgaggcc ggggtgccgg ccattgccat tgacaccctg       720
     tttgcctcaa gaagcggcct gcccaaagac ctgtgggaag agatcgaagg cccctttgcc       780
     ggagagatca gccgggccat caagtccacc ggcaggatcg tggccattca caactgcggt       840
     gacgccccct attttgacgc ccagatccgc tccatggacc cggccctgat caatttttcc       900
     gagcttcccg atgactgcgc ctcccgcagg gagatgaaag aaaagtacgg tgaccgcatc       960
     accctgatgg gccatgtgcc caccccgctg ctggtccacg gatcgcccca ggaagtgatc      1020
     gacgagtgca ggcgccacat cgacgacctg gcgcctggcg ggggttatat cctgtcaccg      1080
     ggatgcgagt atccgcccaa catcagcctg gtcaatgcct ttgccctgat tcacgcggcc      1140
     aaaacccatg ggagaaaata g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page