(data stored in ACNUC7421 zone)

EMBL: CP000859.PE66

CP000859.PE66        Location/Qualifiers
FT   CDS_pept        complement(73762..74082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65876"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV9"
FT                   /protein_id="ABW65876.1"
FT                   /translation="MEQIAENRSLRKDAVEVKFDLRGDPVFAMLDDFVASKVPVNVGYI
FT                   LRVCNISDPEDHCKLPSIVFTAIPEKDVFADSVIISSDLGDGSDEPVFSPKEVKLFFWE
FT                   GM"
     ttggagcaga ttgcggagaa tcggagttta agaaaggatg ctgttgaggt taagtttgat        60
     ttgcggggcg acccggtgtt tgcgatgttg gatgattttg tggcgagtaa ggttccggtg       120
     aatgtgggtt atattttgcg ggtttgtaat atcagcgacc cggaagacca ttgtaagttg       180
     ccgtcgatag tttttacggc gattccggag aaggatgttt ttgcggatag tgtgattatc       240
     tcgtcggatt tgggggatgg gagtgacgag ccggtttttt cgccgaagga ggttaagttg       300
     tttttctggg agggaatgtg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page