(data stored in ACNUC7421 zone)

EMBL: CP000859.PE67

CP000859.PE67        Location/Qualifiers
FT   CDS_pept        complement(75364..75825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0067"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mgm:Mmc1_1803
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65877"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW0"
FT                   /protein_id="ABW65877.1"
FT                   /translation="METNTIDKSFVIGIMNRLEFFKNFTAEEKESLVHFYQHIVAFQPG
FT                   EIIIRDGDRDDTSFFILLSGEAVVTKGKQCRPIARLAPGDFFGEISFLTKTPRTATISA
FT                   EMELIVIKVDEIMIRELGPPVREKIKDNIIAKLVERLRRMNEMVEQLSI"
     atggaaacca atactattga caagagcttt gtgatcggca tcatgaaccg gctggagttt        60
     tttaaaaact ttaccgccga agaaaaagag agcctggtcc atttttatca gcacatcgtg       120
     gcctttcagc ccggcgagat catcattcgg gacggagacc gggatgacac atcctttttt       180
     atcctgcttt ccggagaggc cgtggtgacc aagggaaagc agtgccggcc cattgcccgg       240
     cttgcgcccg gagatttttt cggcgagata tcgtttttaa ccaaaacccc ccgcaccgcc       300
     accatctccg cggaaatgga gctgatcgtg atcaaggtgg acgagatcat gattcgggag       360
     ctgggcccac cggtgcggga aaagatcaag gacaatatca ttgccaagct ggtggagcgg       420
     ctgcgccgca tgaatgaaat ggtggagcag ctttcaattt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page