(data stored in ACNUC7421 zone)

EMBL: CP000859.PE68

CP000859.PE68        Location/Qualifiers
FT   CDS_pept        complement(75864..77306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0068"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65878"
FT                   /db_xref="GOA:A8ZRW1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW1"
FT                   /protein_id="ABW65878.1"
FT                   /translation="MEKNSWLEKTDPLLDAVCRTIGCHAMIAPGEAVLVGVSGGPDSVA
FT                   LLHALVRLQPELAVARVSVAHVHHGLRGAEADADQAFVAALAERLGLPFYTEKIDVAAA
FT                   ARNTGASVEDAARTARYRFFSDTAAAHGYHKIATAHHAGDNAEWVLMNLVRGAGPEGLS
FT                   GIPPVRENIIRPLIHVSREDILAFLTHGGMDYVEDSTNADLTFTRNRVRHHLLPLIEEH
FT                   YNPGIAACLNRVAEIFREESLWIRDMVSGLFEQAVLLCEPGRVVLKAGFVQALPLAARR
FT                   RLVRRVLEIVKGDLRRITFDHAEAVCRGVDRTFGLDLPDAVHVSGNEQELVFSDTAVCP
FT                   ATATPQVKPFSYTLFDTGLGNGSVTITETGITLGFALAPCAAPANLQHNDRRTALLDAE
FT                   KLTCPLTIRNVRPGDRFVPLGMTGSQKVSDFFINTRVAPIDRAACPVVESGGAIVWVAG
FT                   HRMAEHVKLTPASRQVLKAKIL"
     atggaaaaaa acagctggtt agaaaaaaca gaccctctgc ttgacgcggt ttgtcgcacc        60
     atcggatgcc acgccatgat cgcgcccggc gaggcggtac tggtcggggt atccggcggc       120
     ccggattccg tggccctgct ccacgccctt gtccggcttc agccggaact ggctgtggcc       180
     cgcgtcagtg tggcccatgt gcaccacggc ctgcgcggtg ccgaggccga tgctgaccag       240
     gcgtttgtgg ccgccctggc cgagaggctg ggccttccgt tttacaccga aaaaatcgat       300
     gtggcagccg cggcccgcaa cacaggggcc tcggtggagg atgcggcccg aacagccagg       360
     taccggttct tttctgatac ggccgcggcc cacggctacc ataagatcgc cacggcccac       420
     catgccggag acaatgccga gtgggtgctg atgaacctgg tgcgcggcgc cgggccggaa       480
     gggctttccg gcattccacc ggtgcgggag aacatcatcc ggcccctgat tcatgtgtcc       540
     agggaagata tcctggcgtt tcttacccat ggcggcatgg attatgttga agacagcacc       600
     aatgccgacc tcacgttcac gcgcaaccgg gtgcgccatc acctgctgcc cctgatcgaa       660
     gaacactaca atcccgggat tgcggcgtgc ctgaaccggg tcgccgaaat ttttcgcgaa       720
     gagtccctgt ggatcaggga catggtgtcc ggcctttttg aacaggcggt cctgctgtgt       780
     gaaccggggc gggtggtgct gaaggccggc tttgtgcaag ccctgcccct ggcggcccgg       840
     cggcggctgg tgcgcagggt gcttgaaatc gtcaaagggg acctgcggcg catcaccttt       900
     gatcacgccg aagccgtgtg ccggggcgtg gaccggacct ttggcctgga cctgcccgac       960
     gccgtccatg tttccggaaa cgagcaggag ctggtgtttt ccgacacggc cgtctgcccg      1020
     gcaacagcca caccacaggt aaaaccgttt tcgtacaccc tgtttgacac cggccttggc      1080
     aatggttcgg tcaccattac cgaaaccggg atcacccttg gttttgcgct ggcgccttgc      1140
     gcggccccgg caaaccttca gcacaacgac cggcgcacgg ccctgctgga cgcggaaaaa      1200
     ctgacctgcc cgctgaccat tcgcaatgtc cggcccggag accggtttgt gcccctgggc      1260
     atgacagggt cccagaaggt cagcgatttt tttatcaaca cccgggtagc tcccatcgac      1320
     cgggccgcct gcccggtggt ggagtccggc ggcgccattg tctgggtggc cggccaccgc      1380
     atggccgaac acgtgaaact cacccctgcc tcgcggcagg tgctgaaagc aaaaatttta      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page