(data stored in ACNUC7421 zone)

EMBL: CP000859.PE7

CP000859.PE7         Location/Qualifiers
FT   CDS_pept        complement(7279..7734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0007"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: sus:Acid_7091
FT                   ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65817"
FT                   /db_xref="GOA:A8ZRQ0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRQ0"
FT                   /protein_id="ABW65817.1"
FT                   /translation="MQVILMETVEALGLAGTEVKVAPGYARNFLFPRQKAMAATPANRR
FT                   RMEQMRAKIELQIAKERGAAQEAAKKLEGVVCRISAKVSNEGRLYGSVTVGDIVEALAA
FT                   RDITVSKKMVLLRENIKEVGTYPVGIYLYKDVVPEISVEIVADEKAE"
     atgcaggtaa tattgatgga aaccgtagag gccctgggcc ttgccggcac cgaggtgaag        60
     gtggcccccg gctatgcgcg caattttctt ttccccaggc aaaaggccat ggcggccact       120
     ccggccaacc gccggcgcat ggaacagatg cgggccaaga ttgaacttca gatcgccaag       180
     gagcgggggg cggcccagga ggcggccaaa aagctggaag gcgtggtgtg ccggatatcc       240
     gccaaggtca gcaacgaggg ccggctgtac ggttcggtga ccgtgggcga catcgtggag       300
     gccctggcgg cccgggacat taccgtgtcc aagaaaatgg tgctgctgcg ggagaacatc       360
     aaggaagtgg gcacctatcc ggtgggtatt tacctgtaca aggacgtggt gccggagatc       420
     tcggttgaga tcgtggccga cgaaaaagcc gaatag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page